SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_10272 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_10272
Domain Number 1 Region: 597-763
Classification Level Classification E-value
Superfamily C-type lectin-like 1.44e-67
Family Endostatin 0.00000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_10272
Sequence length 801
Comment [mRNA] locus=scaffold751:1135583:1152566:+ [translate_table: standard]
Sequence
MKIPQGPPGQKGDPGTCTCNATALMSSFTMPKMIQGPKGEPGVPGQEGKQGLMGLTGAAG
PPGERGLHGPSGAKGDKGDIGITGPEGSQGQKGEPGRDGISGEKGAQGPPGPPGKGEFSG
YDPEGITMRPGLPGQKGEPGISGNPGPKGEAGIPGSKGIKGEPGYKGIKGDHGKDGPRGI
QGFKGEPGAPGAPGLPGAPGENGRPAEKGDKGDTGPEGKLGPPGPPGPPGVSGSGGINVG
DLGFGTKGDKGDSGARGYKGDKGTKGEKGNKGDAGPAGIPGINGIQGPQGDKGEPGKDGV
SGLPGIPGAKGERGERGPPGATTVANSGDYITIKGEKGAEGKRGRRGRPGPPGPVGPPGK
PGNTGEIGLPGWMGRPGTPGIPGSIGPMGPKGEKGEPGAPSPYGVSVGIKGDKGDDGFPG
IPGQPGREGQKGPPGPPGPPGIPSKGNYYPVPGPPGPPGPPGPPGLSLIGQKGEPGIGRS
HVFGERDYYPPRQGVVTTATRGPLESTTKIVPGAVTFQNTEAMTKMSGVSPVGTLAYIID
EQALLVRVNNGWQYIALGSLLPITTPAPPTTSPPPANPPFEASNLINQIPVKADGTGLRM
AALNEPFTGDMHGIRGADYACYRQARRAGLRGTFRAFLSSRVQNVDSIVRLGDRDLPIVN
IKGDVLFNSWKEMFNGNGAYFSQNPRIYSFNGKNILTDFAWPEKVAWHGSHKLGDRAMDT
YCDAWHSSSSDRYGLGSPLTGGRLLEQVRYSCDNKFALLCIEVTSELVRRRRKSTWRSSC
NTEYSHLRPSFRNAKIESLCK
Download sequence
Identical sequences F4X517
Aech_10272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]