SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_10760 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_10760
Domain Number 1 Region: 340-538
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.98e-56
Family Astacin 0.0000869
Further Details:      
 
Domain Number 2 Region: 979-1088
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-39
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 667-769
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-35
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 4 Region: 814-929
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-33
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 5 Region: 535-659
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 6 Region: 1085-1204
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-27
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 767-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000035
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 929-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000725
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_10760
Sequence length 1224
Comment [mRNA] locus=scaffold456:10976:36123:- [translate_table: standard]
Sequence
MRTFLVLAIVYLLAKIVDCRAVENDTDKNKRGKRRHKFSVEELFNTKFPHIITGDLDTDI
CKADGFLGDIALPNIKYDTEWREQKLNKSYLEELKKYREEILKEGLQVEEEGLTEILQFK
SEHDANKQMLHEHDEMVVQEKPEPIMINRNQYSTGDESDNFSFTARDDDINPVVKDESLK
FRLESSTQVSKKRHSGRQAHRQLSRRTWISKSMKARQSNDDMPLEFSTTTTLTLGDNKYV
GHIHTDGVKEISTSLSEMSTQNVSSNRRRRRHHRKRILRRCSHNQCNRRMHGLIVDASDE
IVSIHDRRLRSIEFYDIEHKQKYLANKSGAYLSRIRRAATARKERVWDHGVIPYEIDGNF
SGAHKALFKQAMRHWENFTCVKFVERVPREHPNYILFTERPCGCCSFVGKRGNGPQAISI
GKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVQIIRDNIMSGQEYNFNKLTEEEVNSLG
LPYDYDSIMHYAKNTFSKGTYLDTILPMEIHGKKRPEIGQRIRLSEGDISQTNLLYKCHK
CGRTFQENSGSFGSPNHPNNSPSGDGERCEWRITATHGERIVLNITSLDIFKSDYCRSDY
LEIRDGYWYKSRVLGRYCGSGKMHEPIVSSGSRMLVTYVTSTRQSGHRGFTANYEAVCGG
DVELDGVGHLESPNYPEEYQSSKECVWKLSVPQDYQVALKFQSFEIENHDNCVYDYVEVR
DGHNNDSPLIGVYCGYKIPPDIKSTGNKLLVKFVSDGSVQKAGFSATFMKEFDECVLTDH
GCEHDCINTLGGYECSCKIGFELHSDGKHCEDACGGFFDDSNGTITSPSFPETYPGNKNC
VWEIIAPPQYRITLNFTHFDLEGNNVYQEECEYDSVEVASKLGDDVLRKHGIFCGARLPP
LITSEGNFMRIIFTSDNSVQKSGFAAVFFTDMDECANNNGGCQHECKNTIGSYQCSCHNG
FTLHENGHDCKEGGCKYEITTPMGTITSPNYPDYYPGRKDCVWHFTTKPGHRIKLVFKVF
EMEPHQECAYDHIAIYDGDSPDSITLGRFCGNKEPHPILATSNQMYMVFKSDASVQRKGF
LATHSTACGGHLMATDRVKHLYSHAKYGYYQYDHRTDCDWIIEAPLGKNVHLSFLSFQLE
YEAECGYDFVEVFSGLDASSPPYGRFCGNSNTTDFISMNEALLVRFKTDDTISNKGFVAI
FVAIDRQDSEENLGGEDNEDQENM
Download sequence
Identical sequences F4WU85
XP_011059855.1.86870 Aech_10760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]