SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_10811 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_10811
Domain Number 1 Region: 405-523
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-16
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 2 Region: 551-659
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000249
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 3 Region: 255-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000458
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Weak hits

Sequence:  Aech_10811
Domain Number - Region: 842-978
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00055
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number - Region: 1001-1025
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00491
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_10811
Sequence length 1104
Comment [mRNA] locus=scaffold303:7146:16771:+ [translate_table: standard]
Sequence
MAATSCYISVKFISTLINVGLPAHAVFTAALQNEYEVSKKQGKGVNCDAFDCPDRMRGGW
QDGCRQRKKSKMREKKLSDNRTEASEGICRRREQDVAGRRISGNRCNRSSQGGSRDGKGE
ARAEGPSGEWGRVPRGGKYRLGDFNRQNDLSEDRSNQDEIGVIREHESVMVKFSTGEANG
DKRRENGGILTASALVPGMPRMPVLVLLGSWGWGFFAIFLLLLATPSPAAIRRADRGHCN
KTVDIYEDVSSPAVTPANWGKPLSCWYRFRAFRGTPRDWILRVRFKKFKVGVLENATTCS
GGYLQIIDGNTKTEVSNRKDPGVYCGESEQPQTFISETSFVRVIFHADNFTDQTYFSFDS
RAEPQFEVYLRYGQHPELYPNRRGEVVPGSYCERVFKDCRLQTCYVQSPAYPGIYPRALH
CKYRLNTRLPFIKLYIENEEFNIDGQRCENIMTCPMRPISSGSEHCPYDYIRVYDGKNES
SPVIGTFCGMGKFPYSIIGTSEDLYVEFVSSPAGPLLNTGFHFNVGNWPGHVETAGVKNG
SCDWLLNSESLVSGNEGIFLSVAHWYPPHTSCTYLLRGRPGEIARLYFPSFRVNRIESPI
QPYDGDCGESLTLYDADWPDDARIIKTFCDTFSKPMEKHDFVSTSNALFVRFESKTGSYS
GSSLYYWAHYDFFNATRFGEPTPGTECDEVFASWKTRSGRLRSPLNTLVYKRPGDPPADL
SCTYSFITDKRLYARVILVIESINFKEHPYAQCGHCWDSRVDRVIIREPNPDGIKGHCLC
RINNNGTPAPTSSPRPPVLRVVSRGERLDLKLLVDGAHAASSYFKWPAPLFEARYEFAHS
PLCGPALLPPATDGEIEFPHYEALGYVTPPRTIKCIWELRVNRERDLWLHFDKIKFASRS
CEDGKLEIFLPGSAEPYLGICGENVSYVREMPIISAAHITPPIDHLAPSGDVIEESPAVI
IQFTGSMAPARAAFKIAWTELFHLPRDGSGALNTGKLEDCGFQCPGDAGCIPLRLVCNGV
VNCPSRNLPLPSILNGTFYEPDDESVETCGGPVSGNGGGFAGPAGWAGAGLGAGLAILLG
LACFIAMCRLCRGRSRSRDIHVPY
Download sequence
Identical sequences F4WK31
Aech_10811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]