SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_10888 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_10888
Domain Number 1 Region: 168-362
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.55e-59
Family Reprolysin-like 0.0000653
Further Details:      
 
Domain Number 2 Region: 379-456
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.44e-17
Family Blood coagulation inhibitor (disintegrin) 0.00028
Further Details:      
 
Weak hits

Sequence:  Aech_10888
Domain Number - Region: 615-651
Classification Level Classification E-value
Superfamily gp120 core 0.0149
Family gp120 core 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_10888
Sequence length 1605
Comment [mRNA] locus=scaffold708:514991:538051:- [translate_table: standard]
Sequence
MNAGRATIWKPAGHHEHADVLTVGFNVDGVERVLDLRLNTDLIPVGYQQLHQNRGTYKVH
TPSKVELCHYQGSVRDVPSSWVALSTCRGLRGVIFDGENLHYIHPEDENLDSRHYLYKHS
DLTTNNTCGYEGTPLHVLPDHREIKRFSRHKRAAEIIRGPYNANRQSRYVELVLVIDKKE
YTALDENLDKVYQHCKDIANIINALYMPLNIFIALIGVQVWSESDEIALSPNGDTTLSNF
LRYRREKLLQDIPNDNAQLLTRITFEGGVVGKALKGPICTFEFSGGVSMDHSNVVGLVAA
TVAHEMGHNFGMEHDGPDCGCPEEKCIMASSSGSSGPTHWSTCSLEHLALAFEHGMDYCL
RNKPQKLFDSPICGNGFVEPGEQCDCGLKEHCDNPCCNVTTCMLHSNASCATGECCDLKT
CRPKTAGTECRTAEHECDLPEYCTGQSEYCPADVFKINGETCNGDKAFCYGGMCRTHDDQ
CKLLWGPTGTSSDSQCYEMNNKGTKNGNCGYNRIESSFIRCNNENLFCGMLHCKHLNERL
EFGMESVATLSHSFINNGGKIIPCRSAIVDLGLTQVDPGLTPDGAKCGPGKMCVNQKCMS
VADLKASVSDGKACPNNCNGNGVCNNLGHCHCNHGFRPPDCLQVGVGGSEDSGPAEDPNG
KNDFITAIYIIFLGVLPAIALFLFGIWYVRNSGQHWKKDVMSTTDRGHNGLLIKTIDRSS
PMSRNIETIDSSLSQDPACVSLLPKAEADERYNNNMFGQFKGFTITPIHSNQSKLAEPTK
PAPPPPGWMPTVAIKTNIAKANMQKCNVPQRSNLLSSNDPSSTAPMLPPLNPGSTARPLI
SSPVLAATTCTSVELVSKVPTRPAPDVPMRPAPPPPTSAPSVKPQRPNSTPLTNVILPEP
EKKLEKGSTLNRIASILRPGSGIMRSNSQSSSRDDKNTNSLPRNQHHKVNKVIDKEILRN
LEISNPIPQTEIEIATPVIPVISTTEVEKRNVVLRAQSMRDSKVTSKPFVQTFGSMRQTT
PVKRPTSIPASTRPTSPPPGPPNITQTEKAAENAIKIPGLPGYQNPPVKTVQKPVENTYD
DCMNLITESSLTKITEESAMNDNIYAVIEEPVPEKNRKNIELEATPVDNEYKLPKRIDTI
HGGPNSLESMGLLSEIVSEISNRNFDSIYSTSTLTRKKKEDNGEDATKNLENMGSNNSLG
GYMNSNHYKIPGGIYSNSTSSKFNSSSSTTSSGYLQPSMINVPQVEKKEASKNISDANDN
LKSVDNSNLNTLKSNNPNINDELSKELGMKPPENSIGYKPFTSTKTRPSHLIHIKKDDQT
ENKVPAKPPLSRTKTPPNVAKSPTSKDILESSVKLARQSSDNTLKSLKSSKVSDTSSTMV
KQSSDASPIARQTQVNASKSSSDLDKEESHTTVSVKNVPCSPKDNLGKFNSPDLVSSCSN
SNQGGTKSPDVVGSNPKFNLSLKTVQKTPTLPKNGQKTPTTPLKPLNITSKTTSLSEKKK
SPTGNASVVKSLSPSVKDANNSGTKPSHLTSKMFAKTEIKNGDGGTAARTNPLQRVASGK
SNVASLQQKFETNKNSSGVARTIPSANNKKPMARTTEVGGGGLRK
Download sequence
Identical sequences F4X4B8
Aech_10888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]