SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11261 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11261
Domain Number 1 Region: 38-120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000157
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11261
Sequence length 788
Comment [mRNA] locus=scaffold8:350980:355244:- [translate_table: standard]
Sequence
MTLAATRPEVTAQIGVHCRCGCIINFGDKALNKILAANTQACPGRSFWLLQAKSNYIIRL
HLDQTQFPCPGQYFRARDGDSLSAELLTDIAFDKSALAIGTIYSSGQNLLLEFFSDEHTA
SGDSCVGGFLGHASIFQKLYENKTSVSLPSETNSTLTVEQWIFWGPAHLATASLLILIFF
ISIFLALQFALKYRKYHIAEDLDTLSEHSVGLPKKCTPRLSKRKAPRAMEDGYDSSETLA
EYEDETSLSSTTLKFRDDDESCTERSVIPNKLHTDEPPVTVSAIMAIGQPEIKYAQPIKL
RTLGSISSANKLMSSNTRCQSSASITESPHIARLHRYTSNPLQSKDSSTSSPLSGTSTLR
NGKETKDRRNRERLLQGPGSEFSLTNPETDMELDYYDYNVANAGAAPGSYLGMDPAFLLW
IPPLSMSEDSQGPSADRPDCFQGTTSPALYRLPESTEGATLTPAEYRRMRHQIASSVEET
RPSLEQQRQDSTSSSSSKNDSSSGGSVLSEDSISESRTARLNERLLPIHRILEDSRTRVS
EESLCSQLAIDRTQCSIPNRLHSTDLSQEQNVLKSGPQDSHVNITDCVVVKSEEKSKQIF
KRYPEEAVLHYGTSKSYVNQKTKDISQNDKKNHCLKNENTSKLSGKSMSSKTQGYINGKD
RVLQSANDSTDIVLTTNLNISTSGSCKYRDFTQFTQPRETNKLSDCTNIPMIEFSGSRLN
SPATARRLTTDNLNISLSKKEIQSPDYGVESDIKTESRDSFYDLIRENEDGIKFADDDDE
YIDNRANL
Download sequence
Identical sequences F4X5N8
Aech_11261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]