SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11334 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11334
Domain Number 1 Region: 47-130
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-20
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 3-52
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000542
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11334
Sequence length 134
Comment [mRNA] locus=scaffold59:515053:534030:+ [translate_table: standard]
Sequence
VAGNIRTKAVLDVETKRGYWLTVYAQDHGVVPLSSSLQVYVEVLDENDNTPLTELPVYYP
SVPENSPASVSVLQIHAFDHDVSPQQFVFTISSGNPEGYFLINSTTGLISTSGRKLDREN
QAEHVLEIFLQTMD
Download sequence
Identical sequences F4X0W1
Aech_11334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]