SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11336 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11336
Domain Number 1 Region: 2615-2828
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.05e-38
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 330-466
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-32
Family Cadherin 0.00062
Further Details:      
 
Domain Number 3 Region: 1055-1166
Classification Level Classification E-value
Superfamily Cadherin-like 2e-30
Family Cadherin 0.00054
Further Details:      
 
Domain Number 4 Region: 1995-2099
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-30
Family Cadherin 0.00072
Further Details:      
 
Domain Number 5 Region: 2101-2212
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-29
Family Cadherin 0.00074
Further Details:      
 
Domain Number 6 Region: 224-342
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-28
Family Cadherin 0.00087
Further Details:      
 
Domain Number 7 Region: 1893-1995
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 8 Region: 1580-1693
Classification Level Classification E-value
Superfamily Cadherin-like 5e-26
Family Cadherin 0.00092
Further Details:      
 
Domain Number 9 Region: 1269-1378
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 10 Region: 539-659
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.00048
Further Details:      
 
Domain Number 11 Region: 2200-2324
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.0023
Further Details:      
 
Domain Number 12 Region: 1787-1890
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-23
Family Cadherin 0.0007
Further Details:      
 
Domain Number 13 Region: 1687-1794
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 14 Region: 852-959
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0022
Further Details:      
 
Domain Number 15 Region: 19-126
Classification Level Classification E-value
Superfamily Cadherin-like 7.25e-22
Family Cadherin 0.0031
Further Details:      
 
Domain Number 16 Region: 1366-1505
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 17 Region: 442-545
Classification Level Classification E-value
Superfamily Cadherin-like 8.17e-20
Family Cadherin 0.0029
Further Details:      
 
Domain Number 18 Region: 647-773
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 19 Region: 961-1067
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 20 Region: 132-236
Classification Level Classification E-value
Superfamily Cadherin-like 4e-19
Family Cadherin 0.0034
Further Details:      
 
Domain Number 21 Region: 1167-1266
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 22 Region: 1483-1578
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 23 Region: 758-864
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000371
Family Cadherin 0.0049
Further Details:      
 
Domain Number 24 Region: 2951-2988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000309
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 25 Region: 2314-2407
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000157
Family Cadherin 0.0053
Further Details:      
 
Domain Number 26 Region: 2839-2879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000652
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 27 Region: 2590-2633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000661
Family EGF-type module 0.025
Further Details:      
 
Domain Number 28 Region: 2918-2956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000395
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 29 Region: 2872-2915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000887
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  Aech_11336
Domain Number - Region: 2570-2593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0182
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11336
Sequence length 3467
Comment [mRNA] locus=scaffold59:544690:567934:+ [translate_table: standard]
Sequence
VTVRDNGRPPLSSTTRVVITVADINDHGPEFEQKFYTVQIPASPANDKPLFQVLAYDQDI
GDNGRIQYSIKGGRGKGKFKIHPTTGMVYSQRGFEAGQEYEMMIRATDHGEPQRSHQTRV
SVQVVEAPKESENPPVFKTNNQSVEITESDEEGFLVALVQANDKDGDSLWYDILDGDKRD
EFFIGRDNGNVLLAKKLDWETQNFYNLTIGVTDGVHTTLTQLLVTVIDINDHRPEFTETT
YRVDISENVEKGERILQLHATDEDEDKKVFYSLHAAQTQASLEIFHVDSVLGSITLNEPL
DRETIEEHVLTVMVKDQGTPAKRNYARVIVTVHDHNDHAPEFISEIIQGKVYESSPIGTA
VVQVCAIDRDRGENAKITYSITSGNVGNVFTIDPDLGFIRVARELDLSISSEYILLVKAT
DHGSPALANTVPVHVMVTMADNAPPRFIQKELSAEIYENQQLGTYVKHVEARSTSSLQFE
IVRGNRDDTFFVNPSTGVIVIKNELDYEKTKFFNLTVSATNMAGASATCNVIVHVLDRND
NAPRFLQALYSGEISEGASIGSLVLTNTSAPLVIKAEDADSELNALLNYDIVEDLPRKYF
HIDSSTGAIRTVMLLDHETIPMFSFHVKVSDLGKPKLSSETTAKVMIAVTDVNDCPPKFS
KTDYNVTLLLPTYKNVAVTRVNAIDPDSSEGAALRYDIIDGNKAHTFDIDAQSGIITVHN
PDRMKKNYLLHVRVSDGKYSSVAQVNVIVEKSENSGLIFQKNVYEGAILENSTKITTVVV
VNVLGSSLNEHIIFSILNPTDMFIIGPTSGAIRTNGIRFDREVCDHYELIVEAKSHPPDR
EKPRVAHVIVNVTILDINDNCPMFVNLPYYAVVSVDAQKGDIITKVHAIDMDSGDNGEVR
YELKKGHGELFKVCRKTGEISLKQNLEGHNREYQLTIAAYDGGITPCSIEVPVNVKVIDR
SMPVFDKQFYTDSVLESIEVHSPLALSIQAESPLNRKLIYSITKGNDFEEFALDFNTGVI
YVVDELDYEQKKQYELTVRATDSVSGVYAEVLVSILILDVNDCPPEFTQDSYNISVSEAA
VFGTPVLRVNSRDNDTGINQQVRYAIQNDTEDSTDLFHIDPDEGVIFLKRSLDHESHESH
HFTVIAMDRGVPSLSSTAHVWMSVIDMNDNPPKFEQPSYTCFLSEHAERGQFVTVVTASD
PDYVDEKLTYTIVGGNEQQTYNIDQSTGIISLINMQNFGEQKLSMLNVSVTDGVYTSFTR
VKIEILPANRHNPKFPNPIVEVTVLENQLPGRLVTSVLAVDEDFGEYGTVTYAIMSEMMK
EIFEINKLTGEIVTRKKLDREEQKRYEIPVMATDGGGRSGFVMVRVKIGDENDNAPVFLL
REYKATIQGNLSLNTPFLKIRAQDADEDEAAKIVYSIYEPQTSPARSLLGINPDTGSLYL
QKSAMPWENQLFELFIRAEDKGLTTHHADVPLSIYIMGFHDVPPLFERKEDKFFVREDSS
VGTPITKLKTVTNSTVTYRIVSGDEDNPLFTIDSHGQITLARPLDRELKDSHLIGVLAET
DSSPPLTALAEITLQVLDENDHAPKFESNPYAISLAENIEEGTSILKVIAHDKDLGSNGE
VRYSFGSDIGELANVFTVDAYTGWISTLVQLDKEKQPEYKFQVVATDNGNPKHFARTSVH
VKLKDYNDNAPAFVDDRYEATVNEDALPGTVVVKLITVDKDTDVNTPIEFYITSGDSRSQ
FQIRSTGEVYVAKSLDRETIDRYELQIVGTDGKYVFETKVTVQVLDVNDNPPYCLRYRYR
EILSEGSHPGAYVLTVLATDYDDEPNAKLRFYLTGDNNDKFSLDKETGVLKTVGQLDRET
QAKYSLTAHVQDRDKPTWECSSQLEILVSDLNDNAPKFTMSTYSSTLPEDVEIGTLVTKV
HATDDDIGINRKIRYEFIDSADGHFLIAADSGIVTLAKSLDRETKAMYNVTIQALDQGTP
QLMGIASLIVNVQDINDNPPEFASKLYFAKVPEIYAVGTEVARVLATSKDTGVNADIYYS
IVGGNEHKKFQIDAKTGVLTIAEQLDYERARDYFLTIQAIDGGIPPLSNHATVNITVTDS
NDNAPIFSEVSYRAFVREDAKTGEKVTQIYANDLDSEENGNVSYYIERGDRQKQFSIDRK
TGQIAVTAPLDREEIASYVLEVHARDNGIPMLSSFVMVNIEVLDANDNPPLFSLPNYTAV
VQEDKPLGHTVLQFVVTDADIEPNADPYTFDFRSGNEGDAFRLEQDGTLRTATKFNNRVK
DKYVLHVRVFDNGSPPLYSDAWVVIKVIEESQYPPVITPLEVIINSYMDDYPGGIIGKVH
ATDQDQYDTLLFSSIPSSPIPSTDLFQIDKIDGTLVALPRLDVGEYRINISVTDGKFHSY
SVVKINIDLVTDKMLESSVIVRFREVSPEDFMLSHRKGFVRTVRNAMNCRLKDIVIISVQ
PSTDEANLIKSRAIRQAVHNDLDLLFAVKKAATSAGSPGFYASESIREALNQHVEELEES
TKLVVEEIVRFKCNKGYCFYGDCQDKITLDPTQITPVSTDVMSFVSPRHKHKMECNCKEG
YAGNHCEVVVNECARDPCPLFKVCVPDSSIQGYSCQCPEGYAGQTCDIDISKCHDESCYI
PRNPISFSGKSYARYKIDKALIRQTIEDRLSLSLRIRTMQPTGNLMYAAGKVDYNILEIV
NGVMQYKFDLGSGEGLVRVSSVYVSDGQWHEIQLERESNSARLTVDGKHIAHGSAPGIND
ILNLQSDDLYLGAEVRQHPSIIGFEDVQRGFVGCMDDVRIARVSVPLHMSGASSVAILKR
FANVEFSCDTATILVPPGVCGSQPCQNGGTCKDMGSDNYECQCHSRFAGLACEIDTDPCA
SSPCLYGGRCKIVPESSDYVCECVGPSLSGKRCEFGRYCSPNPCSHGGVCEEGNNGPICK
CQGFTGDRCETDVNECNASPCTNGGTCVNEIGTYRCICPPNMTGLNCGNPAFSTPIISSH
LNIPWEYLMWIGIAVLLNILLIVIFVAFWRMRTKRTRTRANNINNETRKQMVLNSARPNE
HEFKRSSKLSNLEVIQREPPQCPPRPASYTPSSNNEPATYGNSAAVALNNLDTLRSYGSA
GDELENFPPDYLRNLNRSTPIPPPSLTLANPVSGNATGSDTDSLHKPTWQEQMQLASFIT
DTTKIKNDLKRASPVVPELTTGGLLLNSSRRTPHAVGSSVTSVTSIEDDPRIVGGYHWDC
SDWVRPSQNPLPNITEVPGSEVPDSSSFHSNESNESNTHQLPLMHGPIDPTRDIETLNED
QESEYVGDSECGTEFSEQYHCAETQRLNPLDSGGEGEYKYKSSESYLRHPNSYLPHYNIH
TDTENETNPLNGRLSTLESDEEEEDDVVPYGFPSTRRNRCHKVIEEDEIGSVITTLEERN
SLLGGATSNSDLSTNLCEIDDSEYEITDQKSNGRLWLSGNGITQTSV
Download sequence
Identical sequences F4X0W2
Aech_11336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]