SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11526 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11526
Domain Number 1 Region: 735-1026
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-76
Family Protein kinases, catalytic subunit 0.00000000458
Further Details:      
 
Domain Number 2 Region: 200-388
Classification Level Classification E-value
Superfamily L domain-like 3.97e-41
Family L domain 0.00013
Further Details:      
 
Domain Number 3 Region: 374-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.02e-20
Family Growth factor receptor domain 0.00004
Further Details:      
 
Domain Number 4 Region: 58-206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.64e-18
Family Growth factor receptor domain 0.00000408
Further Details:      
 
Domain Number 5 Region: 3-82
Classification Level Classification E-value
Superfamily L domain-like 4.25e-17
Family L domain 0.006
Further Details:      
 
Domain Number 6 Region: 485-643
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000557
Family Growth factor receptor domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11526
Sequence length 1318
Comment [mRNA] locus=scaffold215:601956:608838:- [translate_table: standard]
Sequence
MCQMHNLEMPSLRDILNGSVGMYNNYNLCHIKTINWEEIITGQGGRYFYVYNFTTPERGC
AACDESCEQGCWGEGPENCQKFSKTNCSPQCWQGRCFGPNPRECCHLFCAGGCTGPKQSD
CLACKNFFDDGVCTQECPPMQKYNPTTYSWETNPGGKYAYGATCVRRCPEHLLKDNGACV
RSCPLKKKAVNGECVPCDGPCPKTCKGVEKVHSGNIDTFKDCTIIEGSITILDQSFEGFQ
HVFQNYSFGKRYDKMHPDDLEVFKTLKEITGYLNIQGDHEDFKNLSYFRNLEVIGGRTLT
EYFASLYIVKTSLISFGLSSLKKIYSGSIAILENKNLCYAESINWTRIKKSSEHESLLSN
NRNETDCIEDGFICDEQCSDEGCWGPGPSQCLSCKNVILGNDCLQDCNAPGIYQADNKTC
KMCHEECDTSYSSCTGPNADQCIKCKHVRDGPFCVPECPSSKYNDNGQCKQCHENCVGGC
KGPENNIGANGCYSCEKAIMNDEIPERCLQKREPCPDGHYYEWVDQLEQGLLKPLAGKAV
CRKCHPRCKKCTGYGFHEQVCQQCTKYKKGEQCEDECPADHFADADTQQCISCFGECRGC
FGSGSNQCYKCRNYKIYIDRIDDSDDNITSFNCTETCPPEYPHKIFPPDSEPYCSVETIG
LGYQMENDFHPAVWGGIGIVLMVFIIIIGVLLYLWRVRTKAKENTVKMTMALTGLDDNEP
LRPTGVKPNLAKLRIIKEEEMRKGGILGYGAFGNVYKGVWVPEGENVKIPVAIKVLHDGT
GANTSKEFLDEAYIMASVEHPNLLQLLAVCMTSQMMLVTQLMPLGCLLDFVRRYKDKIGS
KPLLNWCTQIARGMAYLEERRLVHRDLAARNVLVQTPNCVKITDFGLAKLLDINEEQYKA
AGGKMPIKWLALECIQHRVFNHKSDVWAFGVTIWEVLTYGGRPYENVSARNVPELLEKGE
RLPQPAICTIDVYMIMIKCWMLDAESRPSFKELAEDFAKMSRDPGRYLAIKGDKYMRLPS
YTLQDEKEMIRNLASAMDGPETLLDAGEYLQPKSRAPLPPTISASSTSGSPPNTPVKSCW
PNGKPLAADSPTPQNQQNWDRELLRYGNHESGNASHEAGNSGQRAHYVHPNGHCGHVAGS
DSSSSRYCSDPLKMVGVRDCDVTDDCFNTNVVQQQAQVGNLKLDLPIDENDYLVPTPQPS
VNATQYIDLIGDSKPTESETKRLNNGFRKYPDFLAIQGKTSLDNPEYIMSQDEGPLTPQT
LGIPTPDLEKVLPNGTFGSQIRQRSSEEESDHEYYNDFDRLERELQPLKPFRKNETTV
Download sequence
Identical sequences F4WDX8
Aech_11526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]