SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11560 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11560
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000715
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Weak hits

Sequence:  Aech_11560
Domain Number - Region: 205-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0419
Family Spermadhesin, CUB domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_11560
Sequence length 277
Comment [mRNA] locus=scaffold271:263081:264404:- [translate_table: standard]
Sequence
MNNTYFVSPRYPITYRGGERCSITVQRCNPNICQLRLDFLEATWAQPNATGFCDLDVFLV
SGGSSTVPRICGENTNQHVYVDFNGATPITISVDTNADFAFDRRWNIRIQQIACDSVCRA
PNGCLQYYNTLSGTVMSFNFGTTENVRAPQIGTRQMVNHRYGVCVRMALGYCTIEWSEVD
NLSFSVSGDTGSFDPNIIGTPLVAESGASCTTDFVIIPDPQENGVFDNTDRFCGNGFITK
TSDLKPFVLYVVTNGDEMQEAQNKGFALSFRQLPCAV
Download sequence
Identical sequences F4WHC2
Aech_11560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]