SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11705 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11705
Domain Number 1 Region: 214-240
Classification Level Classification E-value
Superfamily Notch domain 0.0000667
Family Notch domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11705
Sequence length 447
Comment [mRNA] locus=scaffold490:483302:495531:- [translate_table: standard]
Sequence
MYELSPCRHNGLPNNHHGYVPQIAVWLIWSKEKYEAVFHSFNDNILGKSFQNKLCQHVPI
DVVYTWVNGSDPMFLESLQKHVSIVDLSAVTSRFSDKDELRYSLRSLEMYAPWVRHIYIV
TNGQIPSWLDMDNPRITLVTHEDIFLNKSDLPTFSSPAIESHIHRIPGVSDKFLYFNDDV
MLGAEIWPEDFVTQAGGQKIYLAWWVPDCSEICPWAWVGDGSCDYACNTTLCEFDGGDCQ
TTDVPIDSEIMEEEDDYPYKYLQDSHENNNELKLLSILRKKNVYSSRKDAHKGLKNNIPK
DGVPQKFRNTQIFHSAATPLSERKSYREKKGAKGYNSYEKRPTKKNKRPLNRYEIEKPED
LDVSASAKKLKGRDVTDIEWDPMFGYNIVNFVAVFAAISNIVVCKVCHSEVSFTESSKRG
LGFKIVVSCKKCDRNTELPIYQECLRN
Download sequence
Identical sequences F4WVR8
Aech_11705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]