SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_11944 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11944
Domain Number 1 Region: 44-180
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-23
Family C-type lectin domain 0.0035
Further Details:      
 
Domain Number 2 Region: 244-313
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000904
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 177-249
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000202
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 299-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000027
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11944
Sequence length 915
Comment [mRNA] locus=scaffold465:674695:681328:- [translate_table: standard]
Sequence
MPGAFVSVHLEVSKFANIPVQLSLCEAFVYTDQALPIERCPQFRDQPPGSTATYNGKCYI
FYNRHPLIFKEALAFCRTRGGTLVDESNPALQGFISWELWRRHGSDMSIQYWMGAVRDQK
DRTLWRWTGSHQEVSVSFWDPLPGEEDCVRYDGKKSWLWSDTPCSARLNFICQHQPQACG
RPEQPPNSTMMVISESTKISGNVYEVGAIVEYQCDSDSLLVGPLNRTCLDTGFYNEFPPV
CKYINCNYPANIKYGSYILINETTTYLSQVQYICDDGYEMTGRARLICDVDELWNGPPPR
CEPILCDPPATVAHSSIEIERESVLVRNTFNQSLQVNSIVTYTCEKGYRLVGSRQIMCLN
TGSYDRVAPTCTGWAIYWYVFEFRRMATPNELQTRNFDSLLVIPSAARNNMFSLEERFEI
LKTYFQSQCCVAETVRILKRNMGRDRAPTEGAIRKLVRKVREKGMLVDDRSGPRARTVRT
PENIEAVAQKEPRTTLTSPTRATLRPSTPKIRTYLTSRTRTTASTATTSTTLLPSRNVPN
TAELPATVRETVSRRPSIGLNRPVTPSSVNDAGSDHPQDNEISGSGVDHAQAGISAGIPE
PSGPFRVDSAEQPNGTHQAKLNLGAVIALGVFGGFVFLAAVITTVVILIRSPFVYCGGVS
GSGSVRGRRRRGLGGVGALRGGGSGGLGRGDTGMPSRWYTLLALPFPDQHLGRRDLTARR
GNDHPYSFTLSAAHRAGYFSNPSLLQPPLPPQPSTQPPPTTSIITYHHQLLRATLASDTS
QDAKNRGRSSKHYRHRASPDCNTVASFDSSSSESRGGLNRYYRQAWENLHETTGHKAGHP
PLRRKETLDEPGYRENFRGNNTERDGSELVVSDVAAYPSSKHASVSDKKRHHHHHHHHHG
SATPEWRQSQSHHRY
Download sequence
Identical sequences F4WUJ1
Aech_11944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]