SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_12098 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_12098
Domain Number - Region: 112-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 16-68
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0301
Family Obg GTP-binding protein N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_12098
Sequence length 182
Comment [mRNA] locus=scaffold296:862283:864698:+ [translate_table: standard]
Sequence
MAEIVQMFLFLYKSKYRRKRRRDVDDDDGGGGGGGAWFDHNREENCDQRWRCRCRCRCGH
GSGSGSGNATATMPWVPFLLWAALVCWVVHVSAAASTSSSSPTLDAGCDPDTCVNGVCEN
GICVCREGWQGAHCQFCGGKVSCYKEKADEGIVQLKSRYLVLSADVETSKKLKIKPRLNL
HT
Download sequence
Identical sequences F4WJL8
Aech_12098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]