SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_12124 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_12124
Domain Number 1 Region: 7-133
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-33
Family C-type lectin domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_12124
Sequence length 135
Comment [mRNA] locus=scaffold186:650559:656723:- [translate_table: standard]
Sequence
MPLLKLGEKRYYLGIFFKANWYRASQYCRYHGMHLASIASQEENDRLEKHIKDFGLGHEH
FWTSGTDQAEEGTFFWMANGRPITFENWNVGEPNNFRYENGEEEHCLELWNRDGKGLKWN
DSPCSFETFFVCEVQ
Download sequence
Identical sequences F4WBH8
PB21234-RA Aech_12124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]