SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_12871 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_12871
Domain Number 1 Region: 444-725
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-64
Family Eukaryotic proteases 0.00038
Further Details:      
 
Domain Number 2 Region: 277-315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 349-395
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000625
Family Complement control module/SCR domain 0.003
Further Details:      
 
Weak hits

Sequence:  Aech_12871
Domain Number - Region: 409-459
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000951
Family Complement control module/SCR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_12871
Sequence length 730
Comment [mRNA] locus=scaffold369:422144:426516:+ [translate_table: standard]
Sequence
MPVTNACVVFSVTLSFLALLPSLPLQARAQILDYGFSDRYGTTASNGPPGHSKWSGNTNL
SGPPGHNKWGGGGKGSSGGRGPPGLGGGGPPGLIGKRPPGWNKVDTENSSEGENYPRPNS
NENYPRPNNDENYSRPNSGENYPRPNNNKNHPRPNNNKNHSRPNNDDNYSRPSNNENYPR
PNNDENYSRPNNNENYPRPNNNENYPRPNNDENYSRPSNNENYPRPNNDANHPRPNNNEN
YPSSNNSGSIQRPYPDYNREGPHGPGDRISDRNEYPQNRQCRDDEFRCGSNECLPRRVKC
DNKNDCRDSSDEEFCMANRNNDDSCVLPQQPEGGHYELGGCDERCDKRPGDTVPKNSFLN
YTCKSNYMLKGNTISVCVNNRWYQPPSCHKICSPLNSTSVDISCSYHGKTVSCSERILPG
TQATLACKSSYKLPLTNDPAYRELTCLDDGLWDRRLFRCLPECGTSIAHGNTLIVNGFAA
RTGIFPWHVGIYAKENTDRYQQICGGTLINNNLVISAAHCFYDEVYNKLYNESQYAVAAG
KHYRDWNAREKYAQKSLVESIQAGGRYQGARGNFANDIALLKLKTPFELTTLVRPVCVDW
DNTHEREQLQVGHSGKVVGWGKDIKGESTKSLQEIDMPFVPYDQCLSVVPQDFRGYLTSD
KFCAGHLNGSSVCDGDSGGGLCFEKDGIWYLRGIVSVSPENKGTCDYNSYVGFTSISHFR
DWIREAYVNA
Download sequence
Identical sequences F4WQ97
XP_011057474.1.86870 Aech_12871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]