SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13077 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_13077
Domain Number - Region: 96-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_13077
Sequence length 203
Comment [mRNA] locus=scaffold609:331004:342840:- [translate_table: standard]
Sequence
GVMNIWPHSSRAACAVIYLPLELRDFLCHETDPLDHLPALYNIRACRYESWVSLKRKVIT
KCHIMEGCVEQHTEPHEKYDYMATVAWPRQEQPCPIAGDFCMNGGTCLFFETVGEPACKE
KRKEYKRRENVLLTLMSLLESTREIELTFLVTPLCAATDELAVSGVERSFTKCLLSIARV
VELEWKLEWKQLQAFMRRKLCKM
Download sequence
Identical sequences F4X143
Aech_13077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]