SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13312 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_13312
Domain Number - Region: 92-132,167-183
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00213
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_13312
Sequence length 545
Comment [mRNA] locus=scaffold137:250077:254188:+ [translate_table: standard]
Sequence
RSPKFMQSPPIESYRGWWTIPYFSCKTRRWLISYSVNVKPLDVRPGVREFISIDIDISGL
EVNQCDTLTQNHNDEFEAASSNQIAFFKGTHKCHMDTTQCVYQGPGSRVNQNGIGAGWTK
GAYVCKCRQGFYSIRHHLTGFEGILVEAAWKEMRENKSDSYEKVFLCLRCAPGCARCKGP
EPCLATYNWPFRISLLAVSIFCAFGTIVLVAYMYQHRKLKVFKVASPIFLSITLLGCALM
YLEMAAIFPVLDMYSCIATKWTRHMGFCISYTALLMKTWRVSLTYRVKSAHKVKLTDKQL
LQWMVPILLVMLIYLGTWTVSAPPYAEVIADNHDLKFYQCSYNWWDHSLAIGEILFLAWG
IKVCYNVRNAESLFNEARLISYAIYNIAAVNITMIAIHLLIFPRAGPDIKYLLGFLRTQL
STSVTVFLVFGPKVIRVLRGQGDQWDSRARARGVTASFSLNGIGLVPEETTDLYQENEEL
KEEIQKLAARIEFMKIVHMEMHNRHIKPKLGGYFSAHGHGHGHPSTGQSPIAKSSTASFI
LKVCI
Download sequence
Identical sequences F4W7Q7
Aech_13312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]