SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13417 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_13417
Domain Number 1 Region: 4184-4279
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000135
Family I set domains 0.053
Further Details:      
 
Domain Number 2 Region: 4426-4481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000538
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_13417
Sequence length 4650
Comment [mRNA] locus=scaffold19:349428:373382:- [translate_table: standard]
Sequence
MITKHNRQSLGNKIDGFPQNKKVLNNLTRSLRKRKKHVKNSNNKIVNRWNNYTGNNDINE
EDTSLNVRLPIWRVSKSTLAVINMDSTTNPSIMETKIINRPLLAFEKPPSQLENLDHSVD
KAIFPIARRYPNSRRLFDLNASNKNLILSRITSPKSEITVDVQNSAFKGLNSSNKRYLLV
PISKNLYVLKNVRENSRTGVNGIIISKRYKLLEKDKDNATSANLSFKAHMHHDVKDVGRA
YRKKGNLHLFDHDMNYLYSTLESRVLKENENPTKNPVSPSHPDFLHPDIAFQTDPNLIDV
TSKIFEEQIVSPIPDYENISLVDINSRSRINFYDSSTLSSPSSFDISNYDVASKKIANYG
QLSTFTFLSEATLNEINPIRQNGGNYGNSLKYSEFGVELTTTDFRNTFDTLNEYIYTPAT
LKDVEIDLINDKKVFDTPQSQEDDSKFLTESNEDTSITNFIDDISTQYRAVFDASANEDN
IFFPNITNHFVNNGILNSQDIDNQKYGISISSEYNNKMSTHSNDLYYNNRSIDEVLFTNY
TTEVDSFLNKEDYVTSASLLLNTDEILKKAQSNVVENSNALLMSIKPLSSELQKLLGAIQ
LVNQSISNVQSRLCDKKNVGSARTEQESKNRNATNITKLVDKVDYYDSDFSIKSFNNQSL
DKRHIEIGDKSIAERDVKIRRRTIFLNKLMTPFYKHKSSISDLEVQSGRRNFLKKRKLNE
REFSKSGDKLSHSRFNRNLKSLTKNYETRMKPIRQFGLKKMKRTTPILGLSRLIKSDISS
KNFEGGRQNHQKNHQISRSIISPENTFFLNMSGSDKEKKFHPIDPQFYKEATAYLDILEL
LGKTKKVEYATEIWTTQKLTESLPSLIFTTTEFFVPTLTFLPYFIEAPIITTSSTIAEEK
EIFEITKSSLYEYITSPITLSASIIPMSTTLPLFYMTKLTILSMEETAISITDLTITPVV
AITEVTEIPITIPMIEIFTTESVMLLTAFLEDMTDITLKITVPVATETLIEEIPALTVVT
EREIMENISTSLATEITQSSFIETNISLYTFSTLLETTQTELMIETTTFIVSVLTSLATA
SQIATSESVGENITLYKTESTTAIASSPMVLKQTETILSTSTKIAITTLIPEDESPVSQI
EKTITAEETATEVPTTTETPTPTEIIIITTETLTTATEIPMTIEATTITETSILTEILTT
LKTPITEETTSTKTSTLSTTSLKIETTEISTTSKTSTITETSFIKTTITEILPINKTITT
AETPTIETSTASKILTISTIPTIIATTTTEILTSTEILTTLKTPITEETTSTKTSTLSTT
SLKTTEISTIKTTITEILPINKTMTTAETPTTIETSTASKILTISTIPTTIATTMIEIFT
TESVMLLTAFLEDMTDITLKITVPVATETLIEEIPALTVVTEREIMENISTSLATEITQS
SFIETNISLYTFSTLLETTQTELMIETTTFIVSVLTSLATASQIATSESVGENITLYKTE
STTAIASSPMVLKQTETILSTSTKIAITTLIPEDESPVSQIEKTITAEETATEVPTTTET
PTPTEIIIITTETLTTATEIPMTIEATTITETSILTEILTTLKTPITEETTSTKTSTLST
TSLKIETTEISTTSKTSTITETSFIKTTITEILPINKTITTAETPTIETSTASKILTIST
IPTIIATTTTEILTSTVILTTLKTPITEETTSTEISTLSTTSLKTTEISTIKTTITEILP
INKTVTTAETPTTIETSTASKILTISTIPTTIATTITTEILTSTEILTTLKTPITEETTS
TEISTLSTTSLKTTEISTIKTTITEILPINKTMTTAETPTTIETSTASKILTISTIPTTI
ATTITTEILTSTEILTTYKTPIIKETGTTIITPTETTLMPIETKTTIETSTITEITTSTK
ITEFLTTNKSVITPVGTPTSIQILTTSEIPTTSTIPTTIVRTTTITETLTPTEILTTYTT
PIIKKTTGAKILTPIETSTPIEIKTTTETSTIIEISTTIETTTISKILTVTETLTTTETA
FTETPTTSEISMTSPIPTITEITAITETLTLTEIIATTKIPTIKTTVSTKGLTPTITETP
SSTETQIITEILTITESLGSTEIPVTSTTSITTVFFTTSESTTSSMTMSSKEFFPTPTLT
TLTTIITTETAETILIPSTTSIITLLQTLITNTTLSETLYTTISSMFLTTTKGAVTTSFK
TAIPTTSLKVTTTTPLPLVTSTMSSEMPNTTLSTFLIEETTVSLIPTTASSFETLHTKAA
LPIPTTVSTIETILTISSILTVNATVFTTTASTITEEILKSTISPFTYLTVTTPSITQIP
IKPIVMDTGTTAYETTSTLVTSSLLTETITGTTSSIIEYEETKETEEYYETTREEIATVT
STAKLTTTEHTTWITTKEVTIEETTPITFFTTSFSVETISEATSPVIETITLFTITKETL
LIEKIVTVTPETMIEVTLISTETSTMPTIETSTTSTSLAAVATTALLLEETATEITETSL
ITTATATLLPTTKRPEYATILEAAITVTLAPFSELILSIIITSETPVTTSEVISTLSTTV
SEEFTTSTTESPSITYTTQISILLIETTISPIVSISTEPTEESLEAETEYYVAKEPFYEE
EYEEYEEYDTEIPTDKWYYYDEYETTTKETAMTEYTELLKEKATSPPFIEGTTTSLYKIK
TSEFTKYLTHSETASTYINVTSTVATPEISYTEKITSTSILETSTSTIVENVTTVKMETE
LTASTVSKEESTTMWFTFGSTEEYTLPSSTTFKIPTDSLDYLTIPPRYTVVERFTQIWVT
TPKFITKPKEIPKIALTTIPEQVSETETTVEKLTSFFISSTQTTLPEREVIEVFATTTST
VSSEMESIKTVYEVITSAMTGEETIPSVTPFITSEAETEITTIKPVFTTMSKTEREQKEQ
LLQQLLQQLDNLKQYEKEIMEREERLKEKEKQWDIEKKKRLKMMQREKEKEKNITVTTEG
YPTTTTSISITSPIYTIGTNLTMPTTEIEITSPGFEISITTLSLVEITTVPTKTTLFSIT
EKITSEIYTTEEMEEITTEESTSVTYTPEKTIIPYTIKKTTSITYITKEIEETQITDYIT
LTPYVTTSIMDLYNIGLASIETATSYATKEMYTVSYVFETTPFSITEETISVTYTMERVT
YTTEEAIEETTFTPYVTEEIEETTFTPYVTEEIEEALYTTERSTTITYFTEEIEEIQITD
YVTFTPYITTSVVDLYSIGLATIETTTPYTVREIYTTSYITLSEPLFVSSTITSPITLVT
SKFITLPITTFSTRFEEISVTSVTTPTWYTTEETITSPITLVTSKFITLPITTFSTRFEE
ISVTSVTTPTWYTTEETYIATYTDIYGKPLLTSSELEFTLSTMAISTTTEVKYYEEIEKL
KEELRKKEHELKEREKILLEREKKLERDIMEFNKYMKEFEKKKILIIPSEKSTMLTSLST
PVPPTERITIKAQLTTQIERITEKKENRTTTKMGITQYTEMKDIEEKKQTTSVPEKTVTQ
EEEEIITKRICLNVLENTTIPFDKRRRNIVTKKICLPYFPEKNEEKKSIGRLSRRLLALP
STKKIKRSRWDVPLNFRHRRREKETTRKIDNLQLSNYEWLSNITKPLQYFKGFSRIYKKM
KKFPKKIAMQKNTTYDFQNCTSLYEQHVFDYYESVFQPTATFMDSKKYGKRNALFRYDLI
TTRKSDDKTSVRKRDVSSRENNERFWSKKNTANISNEKATIKEDEIYTVNVLHLNYDEEQ
MHKVISAKPDEDELTAILFESSDDIYVTDFGKDKKITTPNYKNEEKNEDNEISDKMEKKM
EEYNDYIEDLIEDYMNYKEHETSTQTYDGRLLDNGNKDKRMTENKTELLNQAWPTEKNTM
YHLGGTRLWELDFVTEPTSVVLCTTDKSKTIDGSLPRTTCFDVVLKRNDKIKSNISYYKH
HLNSNKITKHVSIKNRDASLENITRMNALRYKLRTKQPRVAKKLKRESQKFEPNHYKQES
FEKKRIVRLNDFRCTSEDSTVKNRKLCIANANKLKRQIVRHKDTNKHKKKQVAKSRTSQN
LHSLHNTDNGVVKKKNAYRKTTTANQSLQVRASFSLDEIKALNCSEYKEIQDKIVISMDS
DMEEAKEFPQPHYNIESLKGQKYIKLGELENNLKINSELDSDNDVISLPGLNLNLPCNQD
GNGITWLSSISRPSYTWKRTDGIALFGFVTENGDLELRNVNAKDTGNYTCVMKYMSPDNE
ESVETTYEIHLQVVTLPRYIVHGENRYHVRSCDEEDLDMLVTYLPPKLNNIICEADVCNA
YVLTPSCSRSQITVNILLVPSHIVKLMTVDPKRCNVFCLKAIQDKLSLILSKNLQIFLEK
TIIFRLPHYEQRLVPIVEKSSFARRKRGKTDANVSTGRSSNIGLFSSCPAGYGLRDTHCV
PCNVGTYSEDGTSHCKRCPPGTYQPNHGARVCRTCTNPTTKGCYNMLWNSFSAVMVTLAS
IGAILLICLLLLWIICCAKKKFCVKRIAGLIIRENTFEKENVEEQPLIKDANENEDQQWD
SEYRIKKKKGKFYLYEDEWGSHRIKNVPIISPDSYRSHEDYNNHSLLPYRNKSTLLWGAG
KARTQNGKVTSRTHKACNHRCPRAIATVCK
Download sequence
Identical sequences F4WBZ5
Aech_13417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]