SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13631 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_13631
Domain Number 1 Region: 412-473
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000275
Family Variant RING domain 0.0094
Further Details:      
 
Weak hits

Sequence:  Aech_13631
Domain Number - Region: 32-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_13631
Sequence length 591
Comment [mRNA] locus=scaffold532:292771:295257:+ [translate_table: standard]
Sequence
MEQVIALSTQNPLSLLVKFGMMAWNNSCGNDNCSGHGECHNGTCLCEIQFDGPECHIPNL
SYYIAFASIFFLLAFICLIQLVMCIIAEWQRMKAPSFLRACRVTTQKVLYFVVFLASIIR
GAYFTSPTAFKEGWSRSLLSAYYPLLLSGSSLLVCFWAEVFHLRDIRWDKPQFLSKSFLA
FVVFNILTYSLLFAEFITARTYSQVDRSFYTHVFNGCYAVLLFIVVVFFLIYGVEVFFKV
RGGFLNECQVASIATNKRVADTTKVHTEDQVTAKLFDPGPSTSTAEPVHMQQVNTSQLHQ
SRFGLLSQAFMLFIVVGFLFSETLSEFWKTKVPLYSRNWHDIVFRVIEVGVALWFPCVLW
NCMSPEQLWILNPKRILKKLDLDQGKYIKEIELQEKGASQDTAFLSADAASINSKDCWIC
YDNERQDAGPLIQPCQCRGDVSAVHHDCLRRWLVESSVNADSLVCKVCNTKYNVEHASRL
DWQNSLTPRHCLQTIAIVTTMCASSAAAWTVIQLVEGPIIRMLAAGSALLIIYVCIRFLS
VNTVVAYQRAKISSLNIVNSDSESNVTTIAQVTTISHTISVDVTKSDMAMI
Download sequence
Identical sequences F4WYE3
Aech_13631 XP_011062129.1.86870 XP_011062130.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]