SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_13737 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_13737
Domain Number 1 Region: 278-520
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.3e-43
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.00048
Further Details:      
 
Domain Number 2 Region: 542-635
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000000294
Family Blood coagulation inhibitor (disintegrin) 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_13737
Sequence length 916
Comment [mRNA] locus=scaffold827:295539:311048:- [translate_table: standard]
Sequence
MPVHNPRIARQIHKTWRDCGSSLRSAAIASLLSRTVTPDFFANKTRRLNEYIRHYETLSY
PVEEVHRSHLRAKRSINRDSTVTLKFRAHGKDFHIRLKRDSTTFSNNLIIEGSTGERQYN
SDVSHVYQGNLVGEPGSHVFGSVSDGVFHGKIVSPKSGAWYVERAHYYFPSHEINETLHS
VIYHENDVGDPYLDVRQGDGGGCGITNSDVIEWMESVQNSAAPDEPPKTVPSSNQKEPKP
NVAPWNGDREAPGHKYSREANEPSHRRPRRATRSKENNTCSLFIQTDPLIWRHISEQLHH
DAEKTREEILSLIAHHVTAVNYIYRDTKFDGRTEHRNIKFEVQRIKIDDETACTPQQPYS
EPNPFCLENIDVSNFLNLHSLSNHEDFCLAYVFTYRDFTGGTLGLAWVASASGASGGICE
KFKTYTETVSGLYQSTKRSLNTGIITFVNYNSRVPPKVSQLTLAHEIGHNFGSPHDFPPE
CRPGGLDGNYIMFASATSGNRPNNSKFSKCSIGNISNVLDAIEDNKKRNCFTGAFCGNKI
VEAGEECDCGYDDDECVDKCCYPRQVSELDKIKNDTAKGCNRKYGTQCSPSQGPCCSSET
CQFVPLSHRIQCRAESDCSYNSTCSGRSSECPAPLPKANKTRCNEGTQLCINGECTGSIC
LEWNLTECFLTSSIIPNIDKRKLCELACQNGTDASTCRGTSEFAHMVGLPEGGMSLRPGS
PCDNFQGYCDVFLKCRAVDTEGPLARLKNLLFNKETLSSVAQWITEFWWAVLLMGIAFII
FMGLFIKCCAVHIPSTNPKKPPARRISDTLTRPMNTLRRMRHPHAGGGPGPRSIPPRPSQ
GGHGTRGPSHGYGEGRGAQYYPKGYRSVPTASAPPSSGSADNYGRSNHPELYAGAYSGSG
GGGRSAAYEMRHHNKV
Download sequence
Identical sequences F4X616
Aech_13737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]