SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_15271 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_15271
Domain Number 1 Region: 58-124
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000085
Family Spermadhesin, CUB domain 0.012
Further Details:      
 
Weak hits

Sequence:  Aech_15271
Domain Number - Region: 469-554
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0051
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_15271
Sequence length 621
Comment [mRNA] locus=scaffold182:227702:265157:- [translate_table: standard]
Sequence
MKVREKFQPRLDVPNSARLSGQRDGGRYLGTPTNGTFCQRLSESLTSCDSVEICKRSVQG
RSHCTSDYIAVYSGPTTSSPLLKMLCGKEKTTLVYEGQELLVEFRTGPEVSPFDYNGFVA
TLSFIEVTTEAPTTIATDNTNKTLDSMKSNNYNNRDLHDHRKDQGTVTSSCDLEVSGEKV
RAGHHDTRGKPKSTTCKLLLRGRAYDTGHVSIASYNLSAQSCQSTIEIFDGSLESGTLDT
TNSLEKICSPAQWLPRELASQDKYAEPKRYSSNGRDMTVVLTRASNSPTDEEYMEVSYYF
HDEREGGTQQPASVCDVEYYGLTSPVEGSVVHPEPHRLFAMEGPVKCRQHFIPAPNQSVV
ITVKGSTKQTPNNPCETKCGDSGCHCVSKSLESMDHLLLVSETGHIVTCLCGNYQDWLPV
GIRSWTPVYIEWSRSSRAGLNFHAAYKFINDTYCGDHTTAEPEGEVNGGDLASAGLKLNQ
YYQQKCTWILDSPIDRQLIIEVKSTQSRPCTAWNLTIHEYRKNGDPAGIRLHTFCSRDTH
KNFTLPWKMNTVVVRLQALGRTAPQYTMRWRSQTVIANTRKSGPSPTSNLGHAVRSSSKA
EPRGTALILVFAILLARPFNC
Download sequence
Identical sequences F4WB92
Aech_15271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]