SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_15394 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_15394
Domain Number 1 Region: 952-1216
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.85e-79
Family Eukaryotic proteases 0.00038
Further Details:      
 
Domain Number 2 Region: 625-742
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.35e-30
Family Frizzled cysteine-rich domain 0.00031
Further Details:      
 
Domain Number 3 Region: 756-790
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 825-858
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  Aech_15394
Domain Number - Region: 854-911
Classification Level Classification E-value
Superfamily SRCR-like 0.000101
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_15394
Sequence length 1229
Comment [mRNA] locus=scaffold97:41458:63386:+ [translate_table: standard]
Sequence
MSATESCDDDASPTRRPSFCATAFANPDSWTEFAVDPNPLAEAKRKLKLKTKMETKPEKE
WRNHFEEYLLQFHEKIYSKESRIHSVGLPTKTSLLPEPPRTGNDVPPPIPRRHSATPAVA
PPPIPLRPPAIPKRSKNEKPIPLQLTTRQSNQVTPCKTSDPSSTPSSGMSAAWNSVDSNQ
KLIDLGSFRNHNQASQDYLANYSGKDSQETKEHNDFVADFEQAHFQEEHKLTQNSSFEEL
QKVSLDLEKRLHERIIKSAEAKFEDPNSRQRQLGTMSRHNRQQLSKFTKENESGSCEQKE
TSESKPREEIALPRREIFQKDELKYATILTSGRERRSKFEELQAASKNLERRLHEDDDYR
RRQEMDRRINKDKPPRYEDLEGIPHDLDKRYHGEQRTLEQQQQHPIMRSKYESDMERARN
ILQHNLRKERTGNEKLEKLPKATQTNLPPPLSAICQSPVPKPISVRQDSNVSSDSFSQTS
SPSYTSKTMEAPLLPHKHGKVPDRALVSEPDNSSGRPITKSTSTPASLQTIVRMHAGNNS
SLHHKIIRDMTGSHYVTTGRLRFRFVQVLLNAVALLAIAGGLAAYFKTYPENDFKLENRT
IYTAVIPIPESTRFVIEDKNPAPGVCLPIIVTFCQQHKVPYNYTVFPNYMGNFGQREAQH
ELELYDAVVDVRCYELAALFLCSVFVPKCGSRGRVVRPCRSLCFQTKRRCGFFLKVFGLS
LPDYLECELFPENPSSDECIGHHEVIEAARRAEKPVCTSGFQCDGTRCIPFDWRCDGHLD
CSDHSDEIGCGNCNSTTSSSEPVSSAFGQIVLSKGSSTKSTLSTKSSLHCGERRCMSASH
ICDGVMDCPWGQDERYCLKLSHRNGDVGEGRLEVYHAEMGKFMPACVSHWEPTTSPQEVC
AMLGYKGTVSNGTKLMNDSLSIVLSSEYRNKNLLKQFQGCIKDREPYPMVKLTCVDYACG
RRRSVYGNVRVKRIVGGVESAPGDWPFLAALLGGPEQIFYCAGVLIADQWVLTASHCVGN
HSEVSGWTIQLGITRRLSHTYLGQKLKVKRVIPHPYYNLGVAHDNDVALFQLEKRVQYHE
HLRPVCLPTADTNLTPDTNCTVIGWGKKNDTDSSEYEPAVNEVVVPILPRHLCNSWLAHK
ELNVTDGMICAGYADGGKDACQGDSGGPLLCQDKEDKDRWFVGGIVSWGIKCAHPKLPGV
YAYVPKYVTWIQKEMSKYSEYNSRSNGKM
Download sequence
Identical sequences F4X817
Aech_15394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]