SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_15452 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_15452
Domain Number 1 Region: 507-609
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 286-419
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 838-945
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-22
Family Cadherin 0.00045
Further Details:      
 
Domain Number 4 Region: 941-1066
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 1168-1292
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-21
Family Cadherin 0.0025
Further Details:      
 
Domain Number 6 Region: 727-840
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-21
Family Cadherin 0.0034
Further Details:      
 
Domain Number 7 Region: 406-514
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 8 Region: 1048-1174
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 606-743
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-18
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 1280-1404
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-16
Family Cadherin 0.0051
Further Details:      
 
Domain Number 11 Region: 177-290
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.0027
Further Details:      
 
Domain Number 12 Region: 65-175
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000005
Family Cadherin 0.0052
Further Details:      
 
Domain Number 13 Region: 19-70
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000514
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_15452
Sequence length 1629
Comment [mRNA] locus=scaffold589:85947:102739:+ [translate_table: standard]
Sequence
QFLDACEKFGIVNVERSQNTYVGALVLRQPLDYRERPFYQLLLRASDGLNNGTTGVEIKV
ADIQNSPPEFLDSLTGVVREDDPIGTLVMTVKARDGDRGMPRKMIYELVTNPFDYFLLDD
DTGELRTAKPLDREALENSTGVLTLIVKARELIDGIPGNDKLTVSTAEATVTIKDVNDEP
PTFNRREYNIEIPENVQDGTPLPHLDMTVKDPDVGLNSVFSLRLEDITGAFTVEPVLATG
STSVNIRVTNGSLDYENPNQRKFIILVVAEEVHTNPKLSSTATVTISITDANDNAPSFGS
PTYTATVSETAAPGSPIITITAKDRDSGRFGTAGIVYQLLGQGAEHFAIDKKTGTITVAP
CPTPGTSPCLDYEQQTEYFLTYKATDDNGEGQTTSVSLRISLVDANDSPPRFLQDKYRAV
VDEGAEKFEPELKVQARDKDKTSKITYALVGGNELGLFSVDPDTGEITIKSPVDMTNATH
DWIGLTIQASDGIFVDSALVNITVRDVNNNAPMFPHDIYTASIAEISPIGTVVEEVTATD
ADSGVNAELVYRIQKGAFDDFTINETTGVVTVSRKLDYDEKNTYHVEVIAFDKGTPSLTG
TTTLMIEVENSNDKAPYFTPETQLAEVTEDTPIGTVFTTLKATDPDSTNLEALNFAISEP
ITAIDRNGQRVNDSKSFKDFFAVDRATGQVSVVRALDRDIAATVSVTIVVSDTTAPTLQQ
GRGKLVVTIIDVNHMAPEFLKPWTRENPRYLIEMQEEQPTGAVVGAFTATDADSNIAGYA
IDPPSPYFNIDNITGIVRTSQVIDYEETKQLEFTVVAYDSGVPQLSTTAKVTVTVINVND
QDPKFEKELYNASVKENSPPGTRVIVVKATDGDEGPFGDVSYSLIGEHAADFNIGHETGE
ITVGGATVLDREVTPEITITVMASDGAHINSRRSTTVPVVVKLIDENDNRPIFSQHSYRA
SVAENLSVNPPAPILQVRAADQDEGINGEVWYTIINGNENESFSLNRETGILYPAAALLG
RAGSYRIEVEARDGAGSGPHSDRCYVDIRVTPVNQHKPQFVMPELTNATVEVPENAGVPN
YLILTVKAIDRDPGENGRVSYHLKIGNRNVQETEEFSIDQETGELRSKIILDREIKSKFE
LVLVAADHGSPTAYETLRLLTVQLVDTNDNVPQFYEEYNFHVSENRPKDYFIGKVTAEDK
DEGRHAKVYYYIEAGNEGYAFYMDKSDGSIYANKSFDRETRDKYVLSILASNDPDLYINP
AQSGRPLTHNPEHGHVNVTITVLDENDNPPIFERNDYYAGVNSMANINDFVTKVTASDLD
VGDNGTLHYYVASANLYKYGSEKPSGSIVPSPFNVTQDGKLVTSGYMAEYNQDRFIVEVI
AKETAIPERYAMTRVHVWVFEPSQLIRVILSRPPEEVNSERDEIVSELSNATQSRVVVDD
IRYHPAYAGIQEEPFDPALAALIALLVVLLVGAVTVTVVCCCLRHWVITVPNDIRKKDGL
IKKQIIDELNTTENPLWIEQKLKLYEEQELTMQVFSEPEGGLGGERRGSGVSVGMGDTSQ
DNTYATIQHPLPTNRHRPTTPDYTTLPGNHNLYESAMGFQGSTFQPSPNVMPQLTVDRDG
QPQFVSGLI
Download sequence
Identical sequences F4X0T8
Aech_15452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]