SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_15634 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_15634
Domain Number 1 Region: 239-471
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.81e-37
Family Reprolysin-like 0.0032
Further Details:      
 
Weak hits

Sequence:  Aech_15634
Domain Number - Region: 491-550
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0118
Family Growth factor receptor domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_15634
Sequence length 766
Comment [mRNA] locus=scaffold947:57643:72458:+ [translate_table: standard]
Sequence
MDLFMSRSIKRTEITNGRDLDYIHEHMTREEMLSVFYTGHESVPPYEVVPVLHTMHKRSL
DAKPQIHLKAFGKDISLSLKPTEGLLTANSLPMWIVTRNSSQPDGLHYERVKDIGMNIGD
IYQDAENMASILLHRDTNGKVRVDGTIGSELIIRPLPERVLQEVMSKASTLYEPELLPNI
TSSEDLEHTSHHIVFKKVDRPISDEYSDFSLMEPDHLAKRYRIKRSINSRSRREAPYIIY
PEILCIVDYDGYRLHGGDNVQIKRYFVSFWNGVDLRYKLLKGPKIRISIAGIIISRGRDA
TPYLERNRVGRDAIDSAAALTDMGKYLFRERRLPVYDIAVAVTKLDMCRRQYANDVCNRG
TAGFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPSYLG
GPGAEKCRWEDGYIMSDLRHTEKGFKWSHCSVSSFHHFLNGDTATCLYNAPHEDEALPRV
LPGKLLSLDAQCRKDRGTSACFKDDRVCAQLFCFDAGSGYCVAYRPAAEGSPCGDGQYCL
NGKCVAEHENIIPDYTQNIPTYVRRDSIFNSAIHTRPIFAHYNNTDYRYPWEATQSIPLS
STPSTPTTTTIRTSTYPYKHVTNLFATTVSKYTRTIINNLYTDQYKTRYNNNNSNNSNSS
TGGGFSTTTRRSNFFNSYYTVSTTPKITYGPKVSPFKYKNTVISFSTTTKGYQNGLRNDG
RGTEAGECTDVGSDCAELIDRLRTWLCHLQSVKSRCCASLKTICAD
Download sequence
Identical sequences F4X7S9
Aech_15634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]