SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_15803 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_15803
Domain Number 1 Region: 1003-1118
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-28
Family Cadherin 0.00089
Further Details:      
 
Domain Number 2 Region: 428-534
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.00072
Further Details:      
 
Domain Number 3 Region: 903-1007
Classification Level Classification E-value
Superfamily Cadherin-like 7e-26
Family Cadherin 0.00063
Further Details:      
 
Domain Number 4 Region: 530-628
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 799-910
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 203-328
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-22
Family Cadherin 0.0029
Further Details:      
 
Domain Number 7 Region: 641-738
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000271
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 332-435
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0057
Further Details:      
 
Domain Number 9 Region: 1120-1177
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.0077
Further Details:      
 
Domain Number 10 Region: 90-215
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000143
Family Cadherin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_15803
Sequence length 1179
Comment [mRNA] locus=scaffold301:52921:57471:- [translate_table: standard]
Sequence
MHRIKQRALHAWPWLWLWLFAATAGSPSSDNPVPTTLLPLRGGGDGGAGNDDGDGNGGGD
SMKPSISSIDTATTLPITLDASFSSEPEFRFTQSRYNVSIPENSIGKTYVVPEERMGIQL
ASADSDVDVKFRIMSGDREKFFKTEERTVGDFCFLLIRTRTSNVDVLNRERKDRYVLVVR
ATWSKRDNRNRAILLEADTTVVVTILDTNDLNPLFYPIEYETTVTEDTPLHRSILRVIAE
DADLGRNGEIYYSFAEETDQFAVHPVSGVITLTRPLRYAERAIHELVVLAKDRGALFRSA
GSSRASTAKVTIRVRQVNLYAPEIYVHQLPDIVENSNADIYAIVRVIDRDDGVHGQIASL
DIVGGDPAGHFRVRPAGGSRSGEYNIEVLHLLDRETALQGYNLTLRAMDRGVPQRYSYKF
VPVHLVDVNDNAPVFSREIYEVKVPETAPINTPIIRLKVTDADEGKNALVYLEIVGGNEG
GEFYVNAETGMLYTAVNLDAEKKAFYTLTVSAIDQGNAGTRKQSSAKVKINVVDTNDNDP
TFDQPEMEVMIDENEPAGTSVVRVTAKDRDSGENAYISYSIDNLKKVPFEIDHFSGIVKT
KQVLDYETMKREYLLHVRASDWGLPYRRQAEMQLRVKLRDVNDNRPQFERIDCSGHVPRY
VTISSEIITVSAIDFDAGNIVSYRIVSGNSDNCFALDSASGVLSVACDLSDVKTAERTVN
VTATDGTHFADVNPVHIHLVNAKRNLGSARILTDETGAFKCHDTGVARRLTDAIASAEKN
NMPSRDDEYTLIPSRYGENVHAPEFIDFPNEIRVNESLKLGTVLVQIRARDRDLDYNGKL
VFVISSGDRDSVFGIDPDTGDLNTIGYLDRERENEYYLNISVFDLGKPQKSASKMLPITI
LDVNDNAPKFEKSLASFRISETALNGTNVWRANATDADLGDNARVTYSLVTETNDFRVDP
VTGVLSVFGKLDRERQEIYELRIRARDNSNDTPPLHSDALVRVTVDDVNDNAPTFALSNY
NVKIREDVPIWTVVAVVDATDPDEGAGGDVEYFLSDAMESEGFFKVDKVSGTVRTTQSLD
FEERQVHTLTIVARDRGEPSLSSETMLVIEVIDVNENLYTPVFDDFVVSASVFENQPIGT
LVTTVRAKDVDPPGGDSRIGYSIRGGDGVGIFSIDNEGE
Download sequence
Identical sequences F4WK23
Aech_15803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]