SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_15930 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_15930
Domain Number 1 Region: 173-274
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 126-171
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000112
Family Ovomucoid domain III-like 0.0063
Further Details:      
 
Domain Number 3 Region: 45-139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000581
Family Growth factor receptor domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_15930
Sequence length 277
Comment [mRNA] locus=scaffold808:6456:9977:- [translate_table: standard]
Sequence
MTCRRAFPFTFLAVLVFCATFRRGTPAVAGTIENKSVTEKAQPEGCIECGYYRCPENPGK
CLLGSVPDPCGCCPETGLCARLLDEPCWNASIPLLSPKSRNDGYCARNYLCELRSDLQEK
DAPEAACVCMEQSPACGSNNETYSTPCALHEEAMKLRNSSSLRLQHLGPCESRPWILTTL
EDVVSPFGQRVALNCEAKGFPVPDIFWEFHSADGRRVLKLPGEEHQATIHTSDGPEPLMR
TSWMQLARLDEEHMGMYYCIANNSIGEASTSSFVSML
Download sequence
Identical sequences F4X5Q9
Aech_15930 XP_011066042.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]