SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_16066 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_16066
Domain Number 1 Region: 1876-2139
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.13e-76
Family Eukaryotic proteases 0.00031
Further Details:      
 
Domain Number 2 Region: 1745-1853
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 3 Region: 1597-1703
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00091
Further Details:      
 
Domain Number 4 Region: 1341-1427
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-19
Family Kringle modules 0.0013
Further Details:      
 
Domain Number 5 Region: 298-356
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 9.94e-18
Family Tachycitin 0.011
Further Details:      
 
Domain Number 6 Region: 383-442
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.06e-17
Family Tachycitin 0.01
Further Details:      
 
Domain Number 7 Region: 1071-1179
Classification Level Classification E-value
Superfamily SRCR-like 1.02e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0031
Further Details:      
 
Domain Number 8 Region: 1179-1340
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000523
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 9 Region: 221-277
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000162
Family Tachycitin 0.0082
Further Details:      
 
Domain Number 10 Region: 1434-1473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 11 Region: 1476-1551
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000000157
Family Hairpin loop containing domain 0.037
Further Details:      
 
Domain Number 12 Region: 1707-1746
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 13 Region: 1555-1590
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_16066
Sequence length 2145
Comment [mRNA] locus=scaffold940:357267:381380:- [translate_table: standard]
Sequence
MKGLESELKIEYNLEPKPFGFGQLIYNPRLTTTKPPERRELVLPWHSTEKIHSRVQTTSP
FPIWHQLWDNITSKSGTKNWSPWRKTSGSEIEQRTQIDIPEQISEKVPEQQRNFKFDKLE
QQESLKFPFQYEDFTEFDKNYGYFKNESKYGNRIRPQNEIDFEHKSLKNDENKKMQIEFE
NEDLYEGVDIDSTKPRKGNLLLSRKSQHKIARYNPRLGVECPDNNSTGQFVYPPDCKFFV
NCWKGRAFVQPCAPGTHFNPDTLECDFPHKVKCYEEPAYFKESDSVFQINRKLQKLQEPK
CPPYLIGLLPHHGDCTKFVQCAHGATYIMSCGPGTVFNPTIGTCDWPHNVKGCEDIFKSD
KKVPSASPNFNFEYDSAKYIEAKKITCPADFIGLLPHPETCKKFLQCANGVTHVMDCGPG
TAFNPVTTVCDWPHNVPSCKTGKFDDKVHRMEDTTWIPLVASTTSRSNQNPTFKSTWKPF
TTSSSPSWISTWTTPRPFYDRSEHHVYDYDHTPRESQYQDYGPHLEWKPSNGNLRQSFDN
NYEFQDRQWMENHRIDQNPQPVYHSDRPEGSWSYEHRNQNHRYDHRYYPPGYHHHHHHHH
HYHNYGPTSNPSVNPNWNVGNPTTLIGDQKYDQGYQGYTPNAGNSHWHFDSNHYDHHYFE
HVAQFSNVHNETKFSNVSDLLDSQRTDHDLHPIKQDYNWTMPGLYYPSSNYTFPFAENVL
LNNSNNNKFTKNSNQNKSRQDRLLPTWIGQENTTWNQSNGSFAFNPSTWHDQQKVQMEIQ
TRSWDQGMASQDDKLQQQFGKNIYQQSTVDKETNANTAQWALKTNVLSNSKNQINLESTN
TTEHPRSNFYPNGIYVNANGIKGHYITKEIEDNQKHSKSHQSHSTQNPINWNNIFNNSEN
NYTLFTTTLMTTTEKISNKQLELSRRGREFENTAKEKELHNSDNINDFNLSSASIEYEDD
YWSGNDTKTSNVNLRPPNIIEPEISDYNVDVLDKNIWKPRLVFENKTKTTTASSVIMKIG
PKNTDIELFNIETAPFQEEEPSFPVYYVPPVHPLTHSKKSVRLTPISGQIIRLRGGSEPS
NGYVEIQGELPGWGIVCDSRNSWTLKEAHILCRQLGYSRGAEMAWQGRNNHNNMPTWIAA
NTVTCLGNETRFQSCKFTHNQECHIDRDAIGVRCIPNRIAHCYKDEIPHNGQCYYLADPD
SGFNHAEALEYCKRRNARLIDITNQAENNFVSEWLLQSYPEVSSIMTSGFGFTSMGRTLW
IWANSAHAKFKFTKWWPGWMNDTKQSPWVGSRPLCIVMKRKFSCHERSELICDTDYFFWD
TEDCATTSKGHSFICKRPYDDIGCVYGKGNQYTGKANVTISGNECLSWADKRIVHQLRIN
VVNKEIRDKLEMHNYCRNPNPIKESRPWCFTGTGKREYCDIPACGNIDSKRSMLTGQCKP
KHFECTPGECIPSPWVCDGEEDCTNGADERKCVLDLNLFEKSTKHKLEGYDVEKWLNTPL
KTCALRCKEADFICRSFNHKLNGNVCLLSNSNIGLTGALKPDKEFDYYEMRERSMNCDGM
YICNNRKCINQTKVCDGKNDCNDRSDENICTAENFDYGIRLAGANKSYEGRIEVKILGHW
GQVCDDGFGMINAGVICKELGFDLGALEVRPGGFYGNLDPPTRFMVDQLKCRGNETTLRE
CDFNGWGVHNCQPEEAVGIVCKTAVNTCQEGYWKCKNSPTCIPTPFICDEVVDCPDQSDE
SSEYCDAPFELRLANGSNSLQGRVEVRHHGVWGTVCDDDFTNATAVVICRSLGYGGIAIA
KKNGFFGPGQGPIWLDEVFCHGNESQLYRCEHNHWGQHNCDHNEDAGVICSPGDVNDAES
YWINSQEHSEQNINELLPSNCGQRAKDFDSDEDLIFQKVVHGSIAPKGTYPWQASIRVRG
HSRSNHWCGAVIISPLHVLTAAHCLEGYNKGTYFVRAGDYNTDIHEGTEIEANIEDYYVH
EEFRKGHRMNNDIALVLLKGLGIPLGKDIMPICLPAENAEYPPGLNCTISGFGSIETGKT
TQSKNLRYGWVPLLDQSICRASYVYGEGAISDGMMCAGYLDEGIDTCDGDSGGPLACYHN
GAFNLYGITSWGQHCGKANRPGVYVRIAYYRRWIDKKIRESLVGR
Download sequence
Identical sequences F4X7R3
Aech_16066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]