SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_16091 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_16091
Domain Number 1 Region: 31-77
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000209
Family Spermadhesin, CUB domain 0.0051
Further Details:      
 
Weak hits

Sequence:  Aech_16091
Domain Number - Region: 10-40
Classification Level Classification E-value
Superfamily Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain 0.0392
Family Variant surface glycoprotein MITAT 1.2, VSG 221, C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_16091
Sequence length 268
Comment [mRNA] locus=scaffold772:281233:290442:+ [translate_table: standard]
Sequence
MDPPIMTIAYAGTIKLSKEEVECDSVYEDTDCHDGCVLASPGYPGLYPPNIRCRYLITSG
PRISIAINFTAVLLPYNLVECFFFHLPSSPVRISAFPDRNERATGEKKGKKEKFSTPLLS
LAWISYSSAAIAEEIYRLMKRVARHAAYTIPLWLSYILCGVRFVQTRYSSLITGPLSRYL
LNHSSSKIPSVVKVLELIRSVLQVMGSTFINVTTKQLARTSRRRSTRRVALTHRTDSLFR
LNLLTSALRDDSRSRYVVCRIHTAEKGS
Download sequence
Identical sequences F4X5A7
Aech_16091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]