SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_16560 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_16560
Domain Number - Region: 88-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00785
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_16560
Sequence length 177
Comment [mRNA] locus=scaffold210:16272:16805:+ [translate_table: standard]
Sequence
MANHRANIVNVVEYVRNVDPKQFANIRDKVFEVLEEVNFEEIMNQEIDSDEEILSDDAGY
ASDLSERDTDYVERFVPSLEIRALNGRTKHCIIHCYYTTSGALSICAACMVRLTDTDIAG
LYLVRKHDIGYIDALSGWSCTNCRPPTYIIFPCNKCLHCTQKTIANSIVNESRANAP
Download sequence
Identical sequences Aech_16560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]