SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_16757 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_16757
Domain Number 1 Region: 190-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_16757
Sequence length 564
Comment [mRNA] locus=scaffold883:18598:21021:- [translate_table: standard]
Sequence
MFDGARQVVPLIFVIAILHRAYGDNMIRANEKRHGGTNDYQMCLESFDIHKDKIIRTQDS
RDMGAKYLNVLDVDSRLDCLKYCCETERCDVFIFEEKKPSSCYLFQCGPLHDFKCKFTRH
ANYTSAVRTSYPNVQVEEEVRISHQEHELKSLRKSNEITSDYGFTETPVKPVITQISKVI
VTTPIPVKPACTRNQYECRTSGDCIAIYNVCDGIPQCADGSDEAADLVCPTEKPTVPPII
QMPHPPADMLRYQQIVSQRKPLPPFYPGPEINPKPWDISNLAHQMPQPQNILYPGQPVEV
PQMQIHKNYGSSGYQWDYQPLYEQNKDSYVPANTVHEQHINPYEQQPHIFNHKGSSVIEN
NEANRELYMESKHPYSPHFPSSNKVPVWHENPVQFAPSVAPNSQPKQAVENLPIMTTPTC
DTSEEHKNELTNENKEPIKKEKTNTYSTHVKMSKKVTEKPTLSANEITKHNRAKESKDHK
TVIVIEEHAKTREKSDIIAEHLQIIENDVLRPKGAVVSLSLGLIATAITAALIVCRLRVV
KRRARCGHGPFAHDADYLVNGMYL
Download sequence
Identical sequences F4X6Y8
Aech_16757 XP_011066716.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]