SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17011 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17011
Domain Number 1 Region: 222-427
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.33e-47
Family Reprolysin-like 0.00016
Further Details:      
 
Domain Number 2 Region: 442-519
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 8.24e-21
Family Blood coagulation inhibitor (disintegrin) 0.00033
Further Details:      
 
Weak hits

Sequence:  Aech_17011
Domain Number - Region: 672-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00452
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_17011
Sequence length 1264
Comment [mRNA] locus=scaffold821:5184:41653:+ [translate_table: standard]
Sequence
GEVERLLHEYRQNQELIRNIGGHYYQIIYPVQLRHHEKMGISTREVGVPKFPQRGYGDGG
YQNPRGRLRTGRHFHRTSLLIKAFNHKFRLDLELNTQLLAPNLIQKDFLAGNAEQMSKQE
IEHCYYHGTVRDYPGASAAFHTCNGVSGVIHLGNETFVIHPFYGGDLSKHPHIIFEARTK
VNKGCANSGNLEWRVKNRRQKHIFGLSETTSDRYKRDVREATKYIETAIIIDKAMFDKRN
GSTRAEVVHDAIQVANIADLYFRTLNTRVSVVYIESWKGSNQAQIDNGIDIDQALLSFND
YTMRRMYQVAQDTTQLLTGETFSGGESGVAVPETVCSQRSVGISVDLNTYEPHLLAGTMA
HMIGHNIGMSHDDGRNDCNCRDWHGCIMAQSIVGLENVQPYKFSECSKTDYIEALKSGHG
ICLFNKPNELEIRRSCGNRVIDDGEQCDCGSIEECKEYDPCCDPITCKLTTEAECATGPC
CSDCKLRARGVVCRESTNECDLPEMCTGDTGQCPPDVYKKNGNPCANNAGHCFNGICPAL
DLQCEQVWGYGGIAADQECFEQFNSKGSINGHCGTDSSGHLIKCESENVRCGSLQCQQGS
KQPVIDGMKDLHTRTIISIKNQEYECKATNGRVEGSDIPGMGLVRDGTSCGDNLICVNQT
CTSLFPYIDQEKCPSNHDDKECSGNGVCTNVNKCHCFLGWSGPDCSIEQSIPTALPTTPP
TEVVVKSDSKLPEKKETPYENYHGSNTVFLVGMLMSVVGGVFVLFTLVALCYRSVVVHKN
FSLCLRRKSTVQKYDPPYSKKPQQKSYSGVSGNHHAEAAALDTVNKILTFGSMPQYREHK
PQPKRLGVEEEDGGTGAEEVVSFIDLPPNNLTKLPEKGILKKHGGYGLGGGAIEHVERTL
NQLNGYHEDILEVLKNAASRRDLVGTPSGSNLLDEDALRKSLAECGYPDVYRKDTDGQDN
GIDNGQEEEEDDVELQPPCGTIRIRNLEDLIRQLEHRASARPYMTGQMSPSGSEEIRTSE
TEPDRHYRIDSSVCSESSQGSRRCSRGRDEDASRFVYGRYRQPTSRSPYGNHQHTHQHSH
QMHPEDEGIYETADPDRGSNTRGETPDCESDAFIQAQQQVARWTSEDGGGGGGGGGVQHR
PPQQPPPPPAMPVQQQAQQQQHQLPVEQLPITQRGYYPSPPQIENNLDAGSNAEVESAQS
QQQSEVRGIDVNHTPNINKRPLDDNFSLDCNIMNNDSPKELITNNTSDNENTALLSHHFP
EYKH
Download sequence
Identical sequences F4X5Z5
Aech_17011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]