SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17302 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17302
Domain Number 1 Region: 141-364
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.3e-46
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 385-468
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000589
Family Blood coagulation inhibitor (disintegrin) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_17302
Sequence length 952
Comment [mRNA] locus=scaffold159:3177241:3185711:- [translate_table: standard]
Sequence
VVQGVVTQDGLFDGSVVTRFEEYYIEPTSRYLNKNEDTSPPYHSIAYRTSDVTTPPHPLP
CASHQLHQERSLRDSFDRNYRYNNSQAFYEPLLGEHVALYSRENNARVLTLETNNDVEYT
DAVSGRDRIARHLHKRATIDPRKTTCMLYLQADHQFFARYGTEEACIEVMTRHVQRVNSI
YKHTDFNQDGRPDNISFMIKRVKVHSEDALRDPHYRFPGNYGVEKYLELFSEEDYDAFCL
AYMFTYRDFEMGTLGLAWTGDLKNAGGVCEKNGHYRGSMKSLNTGIVTLLNYGKHVPPAV
SHVTLAHEIGHNFGSPHDPEQCTPGGEDGNFIMFARATSGDKRNNNRFSPCSLNAINPVL
NSKARSPKGCFTEPQVSLCGNGVVEEGEECDCGWEEDCRDSCCYPQRRYPPPEETPCTLT
PRAVCSPSQGPCCTSECNLRFGDKCRDDNGCRDASFCDGRSPYCPPSINKPNKTICNREL
VCFMGECTGSICLAYGLESCQCIPGPNDPPTKACELCCRLPGENQPCLSSFDWNSPPYDI
PDMFSKPGTPCNDYNGYCDVFQKCREVDPSGPLATLRKLLLSDESLATFRRWVAEHWYAA
ALIILAAISLLVASMRLLGKRPDLKLKSVTIIHSSTTETVRLPPEGTEGVTVHPPAVRAK
LPLSRKVREKRCHRKHKDGGHTDKSNNKDAKKKQNQQAKRSSTGQVDDFARKRPAEVLTA
VTQENKRKKITSVRDKGQGTSNNPGGGSSGDNDKRKRKKQHRKEVIDYSAIQADKESETN
ADPKSKVRSWLLASSQCRPETGARTNVNGMPKSKSTPVGLTASGGAVGSRVLKNSSNSLA
RKERARLQVVYKPPFRFSVKLRKSDKVAQAPATAVNHTNANSRTAKLPRTGVLLRTAKRK
DRVRIGRARQIAPTGIGNSGGDLPEPANSDLHTVPSDLEVLLSESEFLFSDT
Download sequence
Identical sequences F4W9W1
Aech_17302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]