SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17308 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17308
Domain Number 1 Region: 53-383
Classification Level Classification E-value
Superfamily Subtilisin-like 8.38e-94
Family Subtilases 0.000000000326
Further Details:      
 
Domain Number 2 Region: 377-517
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-39
Family Proprotein convertase P-domain 0.00013
Further Details:      
 
Domain Number 3 Region: 868-938
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000167
Family Growth factor receptor domain 0.0035
Further Details:      
 
Weak hits

Sequence:  Aech_17308
Domain Number - Region: 932-988
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 0.00409
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17308
Sequence length 1014
Comment [mRNA] locus=scaffold480:346290:385274:+ [translate_table: standard]
Sequence
MEHRSVAKRSTEPHLEMHQRLMNDFRVRRAEQQRAKSRTKRDLIIKRPSNILTMLNDERW
PQMWYLNRGKGLDMNVQGAWAEGITGNGVVVTILDDGLEKDHPDLFKNYDPQASYDVNNH
DEDPMPRYDLVDSNRHGTRCAGEVAATANNSLCAVGVAFGAGVGGVRMLDGDVTDAVEAR
SLSLNPQHIDIYSASWGPDDDGKTVDGPGELATRAFIEGITKGRNGKGSIFVWASGNGGR
DHDNCNCDGYTNSIWTLSISSATENGLVPWYSEACSSTLATTYSSGSTGEKQVVTTDLHH
HCTNSHTGTSASAPLAAGICALALEANRDLTWRDMQHIVVRTAKPANLQAPDWVVNGVGR
NVSHSFGYGLMDATAMVRLARRWRTVPEQHRCEVSAPHTGRTIPPKSQLVLDLHVKDCSG
VNFLEHVQAKVSLMAARRGDLQIQLTSPQGTKSTLLAKRPHDISKAGFSQWPFMSVHTWG
ERPHGTWKLEIHNEGRYLGRATLHEWALIFYGTATLPDRTEYALYNPAGMSIPRRPFVKP
RETIPKNQNTLAKGKQTQHKSDKSGSMSPPYVMNAQIQSQRKGKARGQYKNGKSANRPNP
KPTVQTLRGLTGINRGSNNVAGDMRLITSRPRGRSTPSPVTSTVTQAVATTKAQTTTTSK
QIITQKIIDVVTASPLQRGLILLEPPAKAATNKVPAVFQQYPKIQQLYPVYGGARGTGQH
ATRAKGLDLLQDEQFDPRNLQLDKDTLEEWKLVFFGTDASVEVDDELDKDKPLPPVVHEE
VNNAPSDVRHNTVDTEGDPWTGSRKMDRVSHPEVQRPTTENQTSGCAAFEAGGSGCLGGC
LILLLLAYLTSVPGWRELITSWPASTNMCKPGWNHNNGNCLEQCPPGTYEIQGDDDSGAF
CTICHYSCLSCKGPSDADCIACHADSMFTWNNGRSLCVLNSISWKMQSTVWFHRLTVAFL
VNLGLMIAIIIYFVFTWYIRKRKSVHKYSKVSYSGNGEIHTDAELDNTYVYESE
Download sequence
Identical sequences F4WV05
Aech_17308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]