SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17319 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17319
Domain Number 1 Region: 863-1159
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-76
Family Protein kinases, catalytic subunit 0.00000000276
Further Details:      
 
Domain Number 2 Region: 207-368
Classification Level Classification E-value
Superfamily L domain-like 2.27e-40
Family L domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 367-494
Classification Level Classification E-value
Superfamily Fibronectin type III 4.86e-26
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 4 Region: 671-828
Classification Level Classification E-value
Superfamily Fibronectin type III 8.37e-19
Family Fibronectin type III 0.0002
Further Details:      
 
Domain Number 5 Region: 496-576,677-696
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000148
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 6 Region: 2-79
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000397
Family L domain 0.0023
Further Details:      
 
Domain Number 7 Region: 102-214
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000537
Family Growth factor receptor domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_17319
Sequence length 1413
Comment [mRNA] locus=scaffold220:567818:574667:- [translate_table: standard]
Sequence
MMHLQEIGLHSLTSILRGSVRFEKNPTLCYVDTIDWDIIAKAGKGGHFIKDNKPTNGCPV
CDKKCPTRQTKLDQSLCWNRQYCQKICDWKCENRACNSTGVCCHPFCLGGCSGLTANNCT
VCKNVIINRECKDRCPKGKYEFMNRRCIEEQECLQMQKPREAPDAMKSRPYKPFNGTCVI
ECPPGYMESEEKKGKPPTCQKCEGPSCLKECAGANVDSIASAQKLRGCTHIAGSLEIQIR
GGKNIVKELEDSLSTIEEIDGYLKIVRSFPLISLNFLKNLRVIRGQTLENGKYSLAVLDN
QNLQELWDWNTHPNITIMSSGGPAKLFFHFNPKLCLHEIEKLREKAKLEEFTDHDVASSS
NGDKVACNVTELKTKVTKKSSRGAIIEWKAFTHHDTRSLLGYVVYFIEAPNQNITMYDGR
DACGGDGWRVEDVSAESTTPQPHNGTESQEPVYHTHILTLLKPYTQYAYYVKTYTIATER
SGAQSKVKYFTTLPDAPSPPRALSTWSNSSNELVISWFSPLHKNGNLTHYRIVGRWEPDD
PNFIDQRNYCDEPMPLPEAKPPEEVIAEEEKKHNELEKEFAKTDSCICSDRETTDQSMRE
KEVSSSIAFENALHNQVYVKRLSQQRRRRHTSEMLIAADLAKEFTYDQDRESTNDKVENG
TFTIFERLISSTNLTFVMRNLRHFAAYNIEVQACRERVGNDTKSKNCSTKSMKTYRTLSM
ESADNIPSNTFELKTSGENNSFTIVTLSWDEPPQPNGLIVTYQIEYKRIDIKNIQATVVC
ITRRDFTSMGNSYVLKELSPGNYSVKVRATSLAGNGAYTEVKYFYIPEYGTLGTFWILFW
SILGVVITFTSLIILYVFKKRSMRNVPSMRLIATVNPEYVSTSYVPDEWEVPRKKIQLLR
ELGNGSFGMVYEGLARDVVKGKPEVRCAVKTVNENATDRERIEFLNEASVMKAFNTHHVV
RLLGVVSQGQPTLVVMELMVNGDLKTYLRSHRPDVCENSKQPPTLRDILQMAVEIADGMS
YLAAKKFVHRDLAARNCMVAEDLTVKIGDFGMTRDIYETDYYRKGSKGLLPVRWMAPESL
KDGVFTSFSDVWSYGVVLWEMVTLASQPYQGLSNDQVLRYVIEGGVMERPENCPDSLYNL
MRRTWNHRATRRPTFIDIETQLLQEVNIEDFENVSFYHSPEGIEARNQNNSHSPQTDQDL
EMVALQERLREEEMEGEEDSPLRQDFDDFASFEPRSKNTLSPRYGADSYGETSKATSNFH
DMNSIKVPKAGFDEFGGISGDSLVSSKDTLNSPFVEGSLKSVRSSPFIYKKSTSRSNVSQ
GSLGKSGSPQSLVKRNFLDSPNPSKLQDDPDYENRSPEIMSGIEKREITSLHVEFPSMDV
QVNGDKTENNKRTGDYMNKSEMLNNGYISNTTT
Download sequence
Identical sequences F4WE54
Aech_17319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]