SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17456 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aech_17456
Domain Number - Region: 48-113
Classification Level Classification E-value
Superfamily Cadherin-like 0.000157
Family Dystroglycan, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_17456
Sequence length 398
Comment [mRNA] locus=scaffold708:447182:468507:- [translate_table: standard]
Sequence
TIMHSIIILLSTLVAFIAAESILMTEVFVIPIRPEIFDWNTDGHSDQFSYQPSLLNAPDL
PSWIHYTYSKKDHHGFLYGVAPKDQKYFQLEIVGLNKHTYETRYKVLDMNVLERENLTKY
EVYLKIDNLNVEDMFNQNRTQKLLDIFRKKLWKGAADLYVTFLASAIELGARLPLKPSEG
EGVVVRLGSTVPFSQELNELQEEVKPLWKMPSCPRDFKRTSVEILFREAEFRLDWCSFRL
LEEDQQSLQHESARRGPSANVVDLPSSGISEHTEWRWARSTKASIPTRSYFKEIATTIFI
PVVLLLVLGALLSTAFCLHHEKMTDPESDEYFDELFNIFLLREQPVREKREPTPGEGVGN
NGIQMVQYAMPERGTLKSLSAQPPSPNDSLSQSPRYRD
Download sequence
Identical sequences F4X4B4
Aech_17456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]