SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17704 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17704
Domain Number 1 Region: 5289-5330,5464-5530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  Aech_17704
Domain Number - Region: 5349-5413
Classification Level Classification E-value
Superfamily SEA domain 0.000667
Family SEA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_17704
Sequence length 5836
Comment [mRNA] locus=scaffold527:1419761:1442073:- [translate_table: standard]
Sequence
FELGYSGVTTVLLVSAIPYGKSLPPVGLLTKTARTFVQHGASTEFATQVVGTTLDNGRLY
ARILSTSSRVYKNPTPDSASPYVVYPSRTPEDDWQLRLALDNAPFRAERLSGKINTESNE
EKKDTGNTSKLDELSKENDIFNKRELNMDTQRFKPEKVQPADLPTYTVKQEYVSNNFDSF
DDVSRSFRPRTPKIFKQQAKTPQQKKLDMKPLATVTYHGFADFTTTVGDTVIVFSPSTSP
APMGRPATTIKGDATLRPDDGIAVLKIQPTTVMEHAKTDRPYEEDRKHGSNEQLLSTINR
DNIQPSVTEEIDVESSKRSTEPLLLVPDVETGSLKPTGLVKVVDSTTSLDGTTTHYKSLI
YGTYIGTNYQQIIHTSSNVYFFPDDATVTYGADDTTTEYGTTETEFDDRDTTVEALPSTT
PMTITTSEEEMNELTTPLKGTTDSVLTTLKDILESARRVLGTTESVIPTLDDEIPNDIVP
DPQGRSIKGGSLQNNLQPEHKHDSGNEEEKVTLATRLLPSTIYKTFTYFTTFFIPGGSDQ
TTTSVRSREIVSSEITFLTELIRPASTKNLIRPTTSPGLRQKTLSLSDESLTEEEQTTKQ
DEEIELIFKTLYTTYTYLTTFFQENTSSVSSRQVVETNVITQTVGPNGVSAVVAGLFNKD
ESILISPTTISQNILPSVITNGRTPEKFNKDTELEVPDETTEGDLTTLQQQDTTLHENIP
TESITTIDDFETSDGWTTDLEPSPTPAMASVEIQEQVKTYYTTYTYFTTIFVDDETEIET
RTEVFTNVVTETITPTKVQLVPQETARPTTPRSQSVENKPAPPPEILAYLEALQRQKSQE
EALLLAKKVQQNNTDQVIHAETTENNTEITTEEPTTLEDRFTTERLFRDFQVGAQVTPNP
STEMEVLGSMITDVVSSSSSGGGTVLDMDKRNIVPEDQELSESNNHEVEPAPTLLLQTSY
TTFTYFTTMYKGDQTNVASRLETITNVVTETLRPSIAVPVPTSTLPVTYFTTFTYWTTFY
KGGDTITTSREETVSNVVTSDVSPTPTVELGVVMTYTPTVNSLLEEESTNEEESKITADN
EVTPVDRAGSEKSITENINEPSSITTKPDTQNAVNISSISPEPTTFYTTFTYFTTSYVGN
ETILSSRLETVTSVSVPDIATQQATGRAIGGPVYPSIQTINTNDKTVTSSKTSETFKTGL
ISTIRSSEIHEDTTTHYTTDVYGTYIDGYYARVEKSSTRIETPPLPSSSIATPVLPTGVL
SLNRGSVVDADEVTTVYFTTKQIATLFEGTYAKVIESTSSTKIDEERKASIPPTQGHRTG
LVRLIQGQMENNGTTTFYQSKVIGTSIEGRYAQIIESTSSFFVPSSTRNIAPTSTLPPSQ
STGIQEISPQDEDSGQNEEDDEEDEEDDDGQSSKKKSRLTFSTRKRTFTPVIRPFASRNR
PTFNPKRKGAQAATTITRTDITPTITATLAGKGNRFASSRGRVTSPIGPYSSTLSPSGSR
RFSGRRGSATTSSSVFPAGSTRGRAPPRITPSSVFQSNRRGPTSVRGSSARIATRVSSSA
FPGASSRFRAGIRPSSTLLRGQPTIRHDDQENDANEFTTTTLVTDETPFTEYVDSETNTT
PLQTTTESSRRSTNPLLRFRRPINLTNGRSVTTSRPSTTTTPRRSGNLNRPSAPTIPRVT
NGRTNNRATPPVSTRTRPSNTGLFPPRGFLGRKQEATTEESTESNEEQNEGNEGLEDEPV
EEISDNDYEGSEHEDKRSNINVNRRSGKAVGPVVQIRPFGARTRRIRRQASQLRAYSSRF
RRPAQSSSAKAEERSDSLDAIINKEDIIKTALKPSARYNNRARSLMSSQPQKLFNSDQTA
ETSELSSQQSKPRTRPKQSTGNRNGSVRIKPSPASNNGRQFTLREKDTSSNRSGYKRPTS
PSRTNSRSTSKPDNGRVRPPRLRNGSSKPTESSTNSRRVSPSRSRSSNGRNGNRRVPTRS
RGTFEDIREAPTVYPNFDGTITVTHYVPTEVTIPVVNNGVTEHRTIITQQPSTEVLGPSQ
YSTVTAGDGKPLVVIVSEVTGTNNQGQAEITRFLLHETPTTRISHTLASLGGRRVSQSVI
IPTTVFSVENIVSTIQPSLPGNAPLANILLSQLLLGQLGQPNSLLSQTTPTTQYNTRTTS
YVTTITKHRSTIIPLTFRGKEILTTLIDSSTNVVTATEFITDTVVVTPTAAIPAANINSL
LLLLQQPQTQPQNPNPLLDPLFAAAPFTQSNTLPGEVERRHQPADSDYKHDSYEYYEDDA
EEYQKSSRPRGRGKLNDKKKESKASAKAESSVVTLYVSGRRPGEFSTVLSTVKVGDSVTA
SRRRRDASERAIEVRPSIPPSLHAGPVAVAILAGSEDPIDHAPTQSLESVVGNLYAESVQ
YGRNIDRRREDIDDTWSNEDYINNGRIDDDDEAFEETPRKRVRIRVPVVRSRTARQHKFT
VVRRRPLTPRTKDIAYTTSTTMHTPRRIVVTRVRTIGSGNSINPIDIPADYGSYQPTGFG
RHKVTITRRRKLQSTPTSTQNKVRVTRRKLVAVRPIFPTSTLAIITTGFFTAPSSEYDEY
SDEEDEKEYESEIIREKDHSVITPSLEETPNLIDNKPDEEASLVSSDGSYAISEESTINM
PVIITDNFFFPPSNDEEDEEYEDDDTTTTTENANEVTSLMKDEHPTISPKDEDNIVPNKS
DVEMQPDNITVTTKSQSTEQTIKAPEGSDNTSINITESIVLEDINNTELSTKTVILNEYV
PTTELIVNKDGDDKFATKEQITTIATLEEQTTFMEDITTLNVPDESTTIPDKENITTEEI
TSVTETTMSGKESKENITTEEITSVTETTTSGKENKENITTEEITSVTETTTSGKGQEST
EAAEDTTERSVMPETISEDSKEIPTVRPLQPDVITDSNSTQISLIGTVLPSDTIVIAPSF
ESVIPFETTKSSIRDTDTSNYLGDSYIPSVIPLSANYTRETVPATKVTSEITPEEIEAGL
ADDLYLSLSRLDFPEILPSKSATINLETKSMPDLALEPSTSVYYTETVVTSTRLRTYTYV
VTQLNGLETKVTSSTTVRPRVTTLTLTVPVTVTVTPTVESSADFVSSVYNPVPVVGEYEA
KDEEEGRRFNLETRVMSNGVEVIVAGPTPALRWENSNPQPTLTLSEAVVMLLPQDKPNEF
VTKTCTTTFTYLSTITKDGTTTVSTEQQVVANTATEERHRKPGSETAAVTLDASPTLRTE
VFKTTYTYLTLNTDHPDVNDALESSTRVITNTVTAPQHYLDMILEPSEVPRPETNTYLST
TVLEKTFMEEGRTKIETISDTITQLIVTESAPPPRPTSVTTTLTALDNTDSSVTDMTKTY
YITYTYFNTFLEKGSTIVRTNVATSTDVVLEKVPVRKTTMKTTPVSPTPEPIQIFATKTY
LTTFTYFTTLLQAGPDGETSTTVTSRSHIVENVVTESIAPSLLDAGYMNALLTTAHHSDP
VKNVVTGSTIIFFDDEDQIEPTATSDLPQSTSITEIKKHEKSPTNNLTTTMSTETSEDIN
FDIKPVDSIDKQDNNGTTILSDVSQNKRPNSQSGDDGSVSKPLLSLGSLGINSLSALGPV
ITAMAGLLQGKTAATRRNDSVSLAEIQEVTTQRSPIYIPVAEFADGDIETAESQHIAVHL
ANLNHNYIAETRHKVTSSLADGIPISPGEIITANSDVIIGKPGKMAPRPPQTLLKDEEHI
GMKPPPLPVPNIPVHPVLEVLENNDDVQTQQTAQDPQIQILPAHQIYEEHLKVPVSIPLD
ANHPTAPKQSQKLLSVQSPPKRIASKQDILENDPLLKPPNRPNVEQYANPNVNPKIPEWN
PEKYRRPWSAKDPLTPPARHDEVRFICIIYICIIYIYLCSVCVCVYITYNNFKIHPDKPI
EKPHPTSVMLSSEEQKRPPWAQKDPLLPDSSIIVQSSESKPISTKPIVHQIPHVIDRSTG
QPLLVNIQPSQVANVVIPQGGTQALIFGDTNEPHISGQYFDDPSPYPEPEVGPSFIGIQK
VEELPQYSSEKNPTHYMVPPSPSTNFKVSSPKPGFSSRPHILLPPVRERPLETPEVSVLR
PDKRPSEIHLIKRPDGSGGSGQGHVHTEILVHHKPETINVRPQPASHPSVHSHVHSVHQP
PVRGHFSNGQTPMEQAPPRRVEVTPTEVPHRYIFLGKPDSGNEITLGTNWKSDKKPIRFA
LNNRPRPRPRPTTNRPLDRHVFMERPTGYPPIRKPTYSGLQRPPIKTHNTFMLSHRPPMN
PQLHQEPTRITPNIFTLQIDNQNRPHIYPDKTNIGNVMPPTDNKQNDNVPTGAIEYHNPL
HPNPISKENKHSQVSAMNTQNVLSDHLEKWQTNTHTEQIQLDSDIGASEYINYQNQYYGK
GNRSQEINGQNKKDTTNSQSINQTLTSQTLYGPVISINTVVGKPLEVEQEQDVIYEHETD
GKPLLQGPHGTDLYNTRPYELPVVQGKPFGVYNGHVDPTTSYGYKEDYKSDYEIVHGIPA
PHNEDTRPVMTKTQNGQVTTLNSLERDDTIDLKPPAIIPQFGVEVDRPGRPFSRPIRPDS
RPSLTRNKPEILTKPPIKLEVRPDYSIRRPENVKPNAEIFVNQTLNHRIKINHNLQNWDA
DVAISDIVKSQQKTVENKNSTTSRPIIIGNKRPNIVRPEHGTFTRVHPEYPHILTKPKPQ
VPEPVIISSGTAGLETHGRPNVKFSMSVEAMGEEVDSKTQTERPPSMLVTKHNLSQNKKN
DETLETAYQTNFASSDSQSEQDKIKDVPSRNMMPPPLNGGIGLNQSKKKEQEGLKPPPPP
SSDVLGLSPPPVDITTTHIPIDDRFALMTTDESGLKPPKYVPLKDSTTIAPPNTNMVPPS
PRPSLTRPFLVELLSQDMVPPPPVLTTTRPLEIATIRPAVAVSGSIQIATAVATSHIPVI
QDIESKIPIIHGTVDLPVVVDVADILRPIETRMSEHVSIYTVQPFDTRHVSRISIQSTST
LTTNIVIPTKLRLPQIDHIQPSKSSTIHRDVNPTRSYVLDIPPNPVKRPEHPVFLESSRE
SIPSTRLEPTESLTFIIETEKKQHSTISNIKTQKPQIIEYSIVNKTANKESSIIVTRVDS
SISKVTNTLIPTPGNKTRPEVSNSDTQFTKNIVKATSTIAKNQSNATIHTKPKEVTKFKT
STVTRTKTSVLGSPPTTRTLLLTHTMTTTTVETVTETLLRSTSVVSTVTSTILQPIVTRI
PSTYDNIADNDSIFVVMSDQKPPVPGGEEVEAEYGEEVSRDEQDLMGNEIHKVLTGGILG
APIIPLTPTANQCIPECKSSKSEICAEVGTEMRCVCRPGFARMFPDRPCKPTYTYTLRVG
LDRIGHEFIAYDTALNDSTSATYKRLIVPTKEALDRTLMQSDLRDVYRGLKIAGFIPDPT
KVEFHVQLSDNANETRLKEVLRKYLVGSNYSLGGTEVYASKNLDSIEATDFDECASKEGG
PHHDCSPHAACFNLRGSYQCSCREGWADLSENPTYPGRICSQAPLGCAGCNNKGHCVTNS
LGQEVCECFPWHSVLLIALVTTGAILLGLLAICVGMTCFRRPGRKTGDSRAMIPGTGGDT
SSEGSVTDLAIPHHVPHVLPPPPQMIAPLPPNKRPVRKISAKPRHPPRKATMVSATAISV
NDDQRDRSLTVMIPRAKYRSAPQSPQNYNKTVMSTFAAEEHKLINYLDNGTSSPANRKQS
SATVTRNMDAESTLARSCGETTVEPATKVLRSGDLQVDLDSTLARSCGETTIQAPTKLLR
LDLGEAGSTLARSCGETTIQPPTKVAAARRNSKDTRDNRDTRDSASEGHTMAERDLGSTL
RLPAQHPPLYSPDRVR
Download sequence
Identical sequences Aech_17704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]