SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17718 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17718
Domain Number 1 Region: 840-1054
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.33e-37
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 2 Region: 279-390
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 383-488
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.00084
Further Details:      
 
Domain Number 4 Region: 65-169
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 1079-1125,1158-1306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.81e-25
Family Laminin G-like module 0.0042
Further Details:      
 
Domain Number 6 Region: 172-277
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-23
Family Cadherin 0.00092
Further Details:      
 
Domain Number 7 Region: 2-72
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-17
Family Cadherin 0.0023
Further Details:      
 
Domain Number 8 Region: 783-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 743-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000184
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  Aech_17718
Domain Number - Region: 682-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00096
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_17718
Sequence length 1872
Comment [mRNA] locus=scaffold379:614289:623233:- [translate_table: standard]
Sequence
MIRYSISSGNEKNQFYVHPVTGVVTRLEPFDYDQVQEYRLNITATDMGFEPKQVVAILTI
HVTDINDNPPTFNQSIYEAFLPENSPPDSFVYKVVARDIDSPKYAIVQYEILGGTGKDYF
RIRGNTGVITSDATFDYEEANEYTLDIVAANPDSNPQMVGFTTVMVHITGVNEYYPHFIQ
PVFHMDVSESAEVGTSVGTVQATDQDSGEDGRVYYLFVGSSNDRGFSIGSDTGIVRVSRQ
LDRETQNRVVLTVMAKNGGGIRGNDTDEAQVIISIQDGNDPPEFLQNNYNTNVSESAIHG
TRVIIVRAIDKDIKPQNNQFSYSIISGNLGQAFKVDPQTGDIETAKQLDRETVSSYDLTI
GAIDTGSPPQTGTAMVHIELQDVNDNGPVFDPPEVIGYVSENEPIGTSIMTLSATDPDLP
PNGAPFTYRLIGGRQSDMVTLDKHSGILRTTRRLDRETMPQLELMIEVEDSGIPRMKSEH
NIVVMVTDQNDSPSTPRSVHVMVHSFNGKTPLGKIADVHPNDPDITGAFTCKIIQGASSR
VLTIPTACDLHTNKITSEIGYSLSVSGNDGRHPDVVSKVTVDFLIFSNTTIENSVTLQIS
KLTANDFLSRYYRALLDLLQQKINAGETLTIFSIGENGPDLNVHLAMESPQGYRTRYEVT
DLLMRNQDQIQTLLEDHSFIINYSPCKHMPCENGGSCSDRLAIYDDARITDSQALILTSP
RMLHEMACKCRDGFTGDRCERRQDPCSPNPCLLGGQCRRLGYDFQCTCPNDRDGKLCELE
RGDACASNPCRNGGSCRKSPDSFSFFCLCRAGYRGNHCEAVTDSCRPNPCLYGGLCVGEK
PGYRCSCPEGRYGRHCERSTFGFHELSYMAFPALDSNTNDITMVFATTKPDALLLYNYAP
QTGGRSDFVVLELINGRVVFSYGGARSAITTVTIKTERPVSDGEWHKVTATRNGRVISLS
VSTCKEHGDVCDDCRPGDGTCYAGDVGPTGTLNFNNNPLLLGGLENADPVLERPGQVHSD
DFVGCIHSVSINGRTLNLTNPLASRGVKSTCVRSQRNPCLKNEKDAASVCDVDAQCHDKW
HQAMCQCGSLRAPDCHGALEPITLSEGGFIQFKISEKHRRMQLLEYLYGGSTIWHANRVK
RGLIEDTSFITNPSLKTIGLMFKTVRPDGILIYAATNKHFTSVELRNGQLVYMSLLGSPV
NMSINIEGGLADGRWHNLTLHAYARGLRLLIDGSLTGDELDLAGVHDFLDPYLSVLSIGG
VSQDLYYAHNVGFRSFEGCLANFTINNEVQPFNGSGSIFKNVLYHGKVNTGCRGPIGIGA
ATVADPLSIGITLVIVFFVILLIAILVSFIVFRLRRQNKEKSASSVVNKNTNAIMTGNPL
VGSGNDNLMSRHENTYISDTSDLRGVGHMGPELISKKYKEREINSTAEHRPQRPDIIERE
VTKSPPIRDEHPPLPPPTQISLHPHEHNPEPDIPEHYDLENASSIAPSDIDIVYHYKGYR
DGMRKYKATPPPIGNYGNHHKHTGQQHRHNGPFPPRAMPPPNVNQPPGPAPKLLQSTPLA
RLSPSSELSAQQPRILTLHDISGKPLQSALLATTSSSGGVGKDALNSNSERSLNSPIMSQ
LSGSTASRKAPQSNNENSVNNVSSGPMGLTAEEIERLNSRPRTSSLVSTLDAVSSSSEAR
GPPAHGPLHHHRRHTPPVERLERRNSSTTDESGNDSFTCSEIEYDNGSLVGDKRSDNLFA
KQNDERSSPQGRSNVESSQSKPPLPPNVGNYDGFDSSFRGSLSTLVASDDDLSTHMGGLL
YGTHATNGSPTTTTTTTTAAAEDALSWDYLLNWGPNFESLVGVFIDIAELPDSTSRVPRL
PANIPKPSEEYV
Download sequence
Identical sequences F4WQQ8
Aech_17718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]