SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17732 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17732
Domain Number 1 Region: 426-714
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-59
Family Eukaryotic proteases 0.00052
Further Details:      
 
Domain Number 2 Region: 95-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 217-293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000459
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 134-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 38-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 1-32
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  Aech_17732
Domain Number - Region: 313-359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000834
Family Complement control module/SCR domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_17732
Sequence length 735
Comment [mRNA] locus=scaffold159:2544495:2549117:- [translate_table: standard]
Sequence
FRCYNGDCIAGDLLCDGTPHCRDLSDETETECTKPEILCHRYAFRCNYGACVNGDSVCNG
VQDCIDNSDETQPQCAKNITNNQTGRPTSRPISRPNRCTTNQVACDNGECIHKDNMCNGI
QDCADGSDETSEKCRSIYCPPTAFRCSYGACINGDLRCNGVIECVDRSDEDSRCSETTGW
PSPLPTVRPTTETTRWPVPTPTPTRWPVPTPTPTNACRAPPQPQNGRWKLHRSQCSGGQE
CNVPEGTELGLGSHLIYSCNSGYKLRGPTDVSCSFEGKWLNIPVCTEIRCKALTTASIEA
RCTYDDEWISCESPVPPRTKAVLECQNSYRPETNLLTGQRKNVRCNANGQWEPEPMRCIP
GPLMINIYINNTKFTFHTTFDRNATFIEVLDDRIIIYTNANNPNYPNINIRVSKSNNNIV
TDEPWACCYVAMISPIKIFVVVCGTLPPDVTPTVVGGVRPNITEFPWHATMYRDVPGESK
KFFCGASIIQPNLLITAAHCVYDEINRQPINARSIYILTGNIFRDYDYPFHNPTLVKKNQ
VKHVYIVRNYLGLIGNYLWDIAVLELDRPFVLSTWLVPVCIDTLSDRSVLEAGSYGKVAG
FGRTALGESSAILQALTVPVIPLSQCRSASQNANTEQFITNDKFCAGYTNGSSVCDGDSG
GGLVFKTNSLWYLRGIVSVSLGTIQKDGTAYCDNNLYSLYTEISRHISWIQDVITKIEQN
QIHILCSNESQTRCS
Download sequence
Identical sequences F4W9T4
Aech_17732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]