SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17733 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17733
Domain Number 1 Region: 1460-1478,2592-2767
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-40
Family Laminin G-like module 0.00054
Further Details:      
 
Domain Number 2 Region: 3101-3305
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-33
Family Laminin G-like module 0.00083
Further Details:      
 
Domain Number 3 Region: 2823-3020
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.36e-33
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 2052-2151
Classification Level Classification E-value
Superfamily Immunoglobulin 5.06e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 5 Region: 1967-2065
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 1694-1784
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000186
Family I set domains 0.016
Further Details:      
 
Domain Number 7 Region: 376-456
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000559
Family I set domains 0.016
Further Details:      
 
Domain Number 8 Region: 2267-2409
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000874
Family I set domains 0.051
Further Details:      
 
Domain Number 9 Region: 1877-1964
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000267
Family I set domains 0.018
Further Details:      
 
Domain Number 10 Region: 1597-1685
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000384
Family V set domains (antibody variable domain-like) 0.082
Further Details:      
 
Domain Number 11 Region: 1793-1876
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000255
Family I set domains 0.018
Further Details:      
 
Domain Number 12 Region: 2420-2499
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000952
Family I set domains 0.018
Further Details:      
 
Domain Number 13 Region: 157-247
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000133
Family I set domains 0.021
Further Details:      
 
Domain Number 14 Region: 287-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 15 Region: 250-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000628
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 336-377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000124
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 2511-2591
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000236
Family I set domains 0.026
Further Details:      
 
Domain Number 18 Region: 3045-3119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000738
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 19 Region: 22-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 2761-2802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000547
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 21 Region: 63-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 22 Region: 2186-2302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000858
Family I set domains 0.057
Further Details:      
 
Domain Number 23 Region: 1094-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 24 Region: 105-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 763-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.057
Further Details:      
 
Weak hits

Sequence:  Aech_17733
Domain Number - Region: 698-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0011
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 1401-1443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00201
Family Laminin-type module 0.051
Further Details:      
 
Domain Number - Region: 1151-1202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00642
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 1059-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0316
Family Laminin-type module 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_17733
Sequence length 3377
Comment [mRNA] locus=scaffold298:64610:92018:- [translate_table: standard]
Sequence
DNKAYSPDTDANIDVPPTNLSTPRSCAPDDFVCADGTCIPETHHCDHFYDCRDFTDEQYC
FGCTRDQFQCANGDCIRADQRCNGFIECSDGSDEPEECAMQRNHSRCSAHEWTCNDGHCI
PLHRRCDKRLDCPRDMSDEMDCSYDNYTHETSDLRLKTYPSEQVIKESREVVFQCRDEGL
LRARVRWIRGNGLPLPPGSRDINGRLEIPNIQLEHAGTYICEALGYPPSTSGRQVTVVLT
VEKFEQPATRPPQVCQYDQATCSNGDCIPKSYVCDGKFDCTDGSDEMRCSPHGCEPNEFR
CNNKQCVSKLWRCDGDKDCADNSDEENCAPSPPGSPCRYNEFACSSNKQCIPKSYHCDME
RDCLDGSDEVGCSPVYIVKPPPPMVVLMPGDLLVLTCTAIGVPIPEINWRLNWGHIPAKC
TTVSTNGTGTLTCPDIQIEDQGAYSCEALNVGGFVFAVPDAIVVVKENGNICPKGKFNSE
AKTAEECISCFCFGVATECRSADLFTYQIPPPFDRYKIVSVETIPTIKIHGDISNQISQI
RPLARDGVQLLESFSNDLNVYNIPYFALPENYHGSQLKSYGGYLKYSIRHSGNGTPNYAP
SVILSGNNYILVHKGEEPIPDYENERSVRFFYGEWYKQQGRSEVLASREEIMMALANVDN
ILIKVKYDDSPQLDVRLTNIIMDTADTRNTGLGSASFVEECQCPTGYTGLSCEHCAPGYL
RRESGPWLGQCYRDEPPCPPGYYGDPSRNIPCQICPCPLTNPSNQFARTCHLGSDGQPTC
DCPSGYVGRRCEQCATGYQGNPLIPGDMCVLVQQCDPNGSLSPNADPHTGKCHCKANTFN
LASTNQFGCIACFCMGITNRCVSSNWYRNEIRVSFTNSIRSFSLIESKSTDTPDIVEGIH
LNTINREIVYSEFPNRGNNDVYYWQLPSIFLGDQITSYGGNLKYTVRYVPSPGGQSSRNN
AADVELISANDINLLYYSRESPEPNSQQSFTVPLLEQYWQRNDGTQADREHLLMALADVR
AIRIKATYTTHTDEAALSFVSLDTAEKYNTGKARAVEVEECTCPAGYRGLSCEDCDVGYT
RAIEGLYLGICEPCNCNNHTNQCDPETGTCENCAHHTTGEYCELCEPGYEGDATRGTPND
CTYRSQRPEPCRCNEAGSRSTSCVDGRCECKRNVEGPECNRCRPSTYGLRVENIDGCIEC
YCSGVTDQCHESTLYVQQIPMWVYDSHHGFTLTDSTRRDIIDDGFELNVAMNEIGYRYPD
SRSRRLFWSLPSVFTGNKVKSYGGNLTLTQHITAYPGAQSYKDQDILLIGNGITLFWTNP
VELQPEIPLTYTVPLKEHEWRRLTTEGPRSASRTDLMIVLSNLEAILVRASHSERMTATY
ISDISMDTAVENLIGNRRATQVEACRCPTGYTGTSCETCARGYYRDTSDRTISYLGACNP
CPCNKNEESCEISRSGHIKCHCLPGYTGQYCQDSGVGELMVSLMPMNGEVEPYSTIQFTC
NYDYPDMFYIYFKLSSFDGFPITARSGEIGPIMKTEKGAIRTWFVHMGNVPCNVECHIVS
DRGKELVKIVTSITPVGEPQTTSTQSSVSPPKITVYIQENEFQIVHTGKTVRYHCTGRSR
EHESVNIRWEKEGGQLPPDRSVDDSNGLLVIRDVKVSDSGIYVCQVSDGTNIGYKKVTLT
VGAFPQHLLEIPEPRVSISPSYQQVREGEPVEFRCEATGNPVPQLDWIRVHGSMSPEATF
YNGVWSLPAASKNDAAEYKCVARNNVGIDEKTTILYVQDNPNKPPPQGLPPTITPSEWSG
TSEDVVRLICTPSQHVNVTWTRSGGLPLPYTASQRDGILTITNPTPSDSGIYVCTATSVR
GTETSTTARITIMSRREPPLVTVRPFRQEVKQGTVAEVRCITSGEPGLQVKWSKYTETMS
SRVQQVGDTLRIINVQVSDRGVYLCRVAGPTGNYEASAIIEVEPREAPVLELYPQDIQTV
ILGGSADLQCRAKAGFPAPELRWSRVDNRPFASNIEQLPSGLLRLSNITANDGGAYICSA
SNEVGSTSVIAHIEVQSMPVITITPQHGILQVKRGSRVRLMCSASGHPQPNVAWSKYVNG
ITIQDTYSRTAATPLSAVYEIFSVSPDDEGSYTCTATNAVGIAEERVQIRIEDDDDYVPC
TGDRGDIPCDDDRQRPPDSVKGGVLIPKDYLRIPDGGKVEMRCQVFGPDGDHIYLDWKRS
DHRSLPEGSTVHNGVLSIPTVDRNAAGEYICLGLDPAGTVLFRAKSHLEIISPPRIELNP
TRQTVGPGENPSIICTATGDEPLHIEWKAIGRPLPYSVSDSEHPYDNARIRAEQRDVVTH
AGNSVRLRCEVRERATIHWSREGLSLPTNARIGEDYLELTQVKPEDSGRYICQIQTSRGV
SSDYINFNVSPAAVPSVSIEVSQDPINIGDTVDIHCTYTGTRNPRYRWTRPNHVSLPTNA
QEYGNVLRLTNVVVSDSGPYRCTVDTSEGVLAKDFNLIVHGGILDEPAIETKLAPYGSSL
EMDCRLDLDPPIQFQWNKLGGLLPRDSQTYENKLKLTNVKAENAGTYICSGNNEESRVEV
PTVLVVTGVVPNFSQAPESYIAFPPLPDSYLKFNIEISFKPESYDGILLYNDESGHGDGD
FIVLSLNNGYPQFKFNLGSGPAVIRADKPVTLSEWHTIKIQRNRKEGTMLVDGEGPYKTV
ALGRRQGLDLKEPLYIGGVPSYSRINVQAEANTGFVGCISRLVLGEKQVDLIGDQTDSVG
ITTCETCAENPCNNGGVCQEAATKNGYTCLCRASFSGKHCDNIGQSCYPGACGEGECIDE
EAGGFHCYCPIGKTGSRCEHSVNVYDPSFHDDRAFIAHETPKALRRLKVAMSFNPVDSGD
GILMYCSQNDEGLGDFAALVIKDRHVEFRFDIGSGIAAIKSPHPVQPGVWAHVTVNRDFK
DAKLSVNGEPFVEGKSLGAARTMNLNTPLYIGGVDHRRITINRNVGVDRSFRGCISELEV
SSVSLDIMKSSIDAANIEDCSEPHPNQTMIHTTITTPASTQPPTTLYYPCSSNPCIHGQC
QNLNDDYSCTCEYGYAGRNCEKMQKQCEFLTPCRNSGTCTDLHDSYKCDCRLGYNGQNCE
KLAEITYDVAFKGDGWLELDRSVMMHEEEREVFGLEISTNKSYGLIMWHGQTPNDLTPDD
YIAVAVVDGYVEYQYNLGSGPAVIRITAQRVDDGERHRIILKRQRSDGSIELNGEHTESG
VSDGLQQILDARGNVYLGGLPDYAMTYGKYHDGFSGCIYTLEVQDSGAIDIGEKAIKGVN
VSPCTRVRWIPSSLVFTDADADGFDAFVPPPPVNIIHPKPASNLAAYDMTSYSLLIILQN
LIALTRDIKEQSVLLTL
Download sequence
Identical sequences F4WJM7
Aech_17733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]