SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17765 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17765
Domain Number 1 Region: 36-522
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.28e-110
Family L-arabinose binding protein-like 0.0000000196
Further Details:      
 
Weak hits

Sequence:  Aech_17765
Domain Number - Region: 393-410,533-595
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0103
Family Growth factor receptor domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17765
Sequence length 937
Comment [mRNA] locus=scaffold233:44641:65412:+ [translate_table: standard]
Sequence
MHQRVPWPLLLLTLSLQRLTSLSTVQSRMHNEAVLIPGDIVLGGLFPVHEKGSGPTACGP
NIYHRGVQRLEAMLFAVDQINQKDDILPGVMLGVHILDTCGRDTYALNQSLHFVRASLSN
IDISVLECADKSIPRVKRTASAGPIFGVIGGSYSSVSLQVANLLRLFHIPQISPASTAKA
LSDKTRFDYFARTVPPDTFQSIALVDVVKSANWSYVSTVYSEGSYGEYGIEVFTREATER
NVCIAAALKVPSAANDKVFDDIIQRLSKKPNARAIVLFTRAEDARGILEAARRSNLSQPF
QWLASDGWGRQSKLIEGLEEEAEGAITVELQSKNIPGFDSYMESLTPENNRRNPWFGEYW
EEVFGCTLQNNATTYERFGSQVERKIGTGNQSYLICPFGLKLSTASGYEQESKVQFVVDA
VYAFARALSKLRHDLCGRDEGLCSSMTNYDRGAFYKNYLLNVSFVDDAGSEVKFDEHGDG
LARYEILNFRKGTNNNGANGYHYRVVGKWYNSLDIRTEEMVWARGTKDIPISACSLPCEP
GMIKKQQGDTCCWVCDQCEAYEYVYDEHTCMDCGPGFWPHPDKRGCYQLPINHIRWSSAF
AIVPAVISCLGIVATLAVACLLFQHRDTPVVRASGRELTVILLAGVLVCYLNTFVLLATP
TTATCVLQRFGVGVSFSAVYGALLTKTNRIARIFASASRSAVRPRYISPTSQVCIAAALI
AFQVDGSFSTPEVVLTLVWMIIEPPGTRHSYPDRRQVILKCNIQDMSFLFSQLYNALLIL
ISTVYAVKTRKIPENFNESKFIGFTMYTTCIIWLAFVPIYFGTGNAHETQITTLCVAISL
SASVTLVCLYSPKVYIIVFQPDKNIRGKVCIGSTFKKQSSSAGASSMTKYTGCESASENV
PLQGALTSAVRTSVGVTEISLTSSTTSKTNNEQVAQL
Download sequence
Identical sequences F4WFH0
Aech_17765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]