SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17768 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17768
Domain Number 1 Region: 1363-1616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.11e-84
Family Eukaryotic proteases 0.0000458
Further Details:      
 
Domain Number 2 Region: 1629-1662
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000103
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 1085-1123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 67-183
Classification Level Classification E-value
Superfamily SEA domain 0.00000068
Family SEA domain 0.015
Further Details:      
 
Domain Number 5 Region: 1023-1058
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  Aech_17768
Domain Number - Region: 1054-1083
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00209
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17768
Sequence length 1666
Comment [mRNA] locus=scaffold88:1800922:1807754:- [translate_table: standard]
Sequence
NDYYLSSRSPWSKTSVTRRNGNTTWRFGSAMLIISAMLVLVVVLAIAGLALWMGAFRTDS
KNAIIGFSCSIRIIRGERYNPMLKLNTSMVFREKERKFKNIFELLFRRSVLGLSYKQTMI
DKFENGTLKVFFRLYLDRRKIPRSIVNIEDTIQDIIAKETYSISSLFKDMELDLTSTSVK
RINQENIVNQKQGQQKHTMITKNGLLRPNRNSSLIMSSKSKTKPTKIDSEPNIDFNNIPT
IQGTYRATKINITAENSTKGISEPIIDNKGLATTRRTPLQKHTTTSEKVLNRVESSPTDE
PSTLFTKSTTAMINKDKLNEKYENEMKTTSSGTTTVRNNLNIFKDFLNPNFENNSPWKPI
VPGYVNTEFKLLPNDDVRKTSYTESTTRTAISRTSDFHDNVKMPNDGTSTTSTVPKLPLG
SVNFRDVSEINTFDIDNTDFPRDRIDPGLTKSNNEKLDIEVAGQLPSEMYSVKLKASSYD
GNERATSLSLSNSESSITRGVPENISIQNNTFQEKHKDSNGTRKAETKFDNSTSSIEPNE
KIMNDSLTSGVGVAEPVLDAEIELEAKNRYKGSSILTLTTDEDMLRNRKVNINQQPIYTS
YNTPDLNGGSLGSSLIENPATTKPFRHTIPVDKITSVVNYNINVPFDNLAPPLSDDTSTD
EKLFQDKLLTPLPPKRIVEVETSIVEHDDTIAQLESGQITSTELNIVKNDTKSYFSTTES
YSEPKLIAKDSSGKRGVSRNSTFIEIDTVKHTPGESEENWESQNADEVTVNNDELQKKKI
YNETLKAYVVENLVTLAPIKSNTGIGRPVRPKPKIDFSDTTLLEQLFGVRDYMHDRDTTN
TEATSEAISSHKIRNSTKSDEKNSNHKSTIVEQIVEVVTSISTRVSSNIKNDPVILKFIV
TNSTNPVVHSEKSSTSNNETDKASESTVNATETILPNNLNLSEILQSQDHALSLDIEELK
KIADVVTGNETLKNASSEFTLSRDGLEIFTKVLNKEEDETYETHTVPTIQKLNKTNIGDC
VGFLCGDGKCLDSSAICNMLVECPDAEDEANCTCADFLKTQLLYQKICDGIADCWDYSDE
SNCDWCEKDQFVCGNSKSCVDTDKVCNGFSDCPGGEDEKKCTALIDNTHEENIAESRIDL
VLMKNLSKNNSEMIKRIDQVIERDRESSITERDTTTLYIDNLQSERLINDKNDLSSKLIN
QELARNRDVEESNIEVVVSSRETSSNVLRNGLIPENNLHIKDNRTFPVVKVYNNNEIDNY
NNKGILSIRKNGKWGKLCFIDTNSLTQEQHARQVTWSIEDLAKAACKAITYQDYEMVEKV
LDQNPPSNQFYYTLSYDKSDLSDRTALSFKSSQCPNGEVLKIRCKNFECGIRTQVASTAR
IVGGASSSVGNWPWQVALYKDGNYQCGGALINERWVISAGHCFYHAQNNYWVARIGATRR
GSFRSPHEQLLRVDYISLHPDYVDHVFLNDIAVIRLERAVSFSDYIRPVCLPKTPVLTGT
VCVVTGWGQLYEIGRVFPDTLQEVQIPVMSTEDCRRKTLFLPLYRITNGMLCAGLENGGK
DACLGDSGGPLVCLSPFENRYVLQGITSNGYGCGRRERPGVYTKIYSYMSYIDYVITQKD
IQPSAVEFCKGHRCPLGECLPKSRVCNGFLECSDGSDERDCSTISR
Download sequence
Identical sequences F4X6W9
Aech_17768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]