SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17776 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17776
Domain Number 1 Region: 1802-2051
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.57e-57
Family Ankyrin repeat 0.00000000922
Further Details:      
 
Domain Number 2 Region: 506-636
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000785
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 1125-1263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000091
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 670-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000154
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 5 Region: 708-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000045
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 6 Region: 811-943
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 405-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000011
Family EGF-type module 0.002
Further Details:      
 
Domain Number 8 Region: 443-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000153
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 9 Region: 211-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000156
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 10 Region: 746-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000139
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 11 Region: 631-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000447
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 12 Region: 1096-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000461
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 13 Region: 123-253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000143
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 14 Region: 942-1057
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 15 Region: 366-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000357
Family EGF-type module 0.0016
Further Details:      
 
Domain Number 16 Region: 249-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 17 Region: 1294-1330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 18 Region: 1255-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000228
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 19 Region: 61-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000965
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 1332-1369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 21 Region: 98-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.008
Further Details:      
 
Domain Number 22 Region: 286-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 23 Region: 328-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 1436-1468
Classification Level Classification E-value
Superfamily Notch domain 0.000000379
Family Notch domain 0.0044
Further Details:      
 
Domain Number 25 Region: 1476-1508
Classification Level Classification E-value
Superfamily Notch domain 0.000000458
Family Notch domain 0.0029
Further Details:      
 
Domain Number 26 Region: 1396-1428
Classification Level Classification E-value
Superfamily Notch domain 0.00000628
Family Notch domain 0.0032
Further Details:      
 
Domain Number 27 Region: 786-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000742
Family EGF-type module 0.019
Further Details:      
 
Domain Number 28 Region: 1070-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.026
Further Details:      
 
Domain Number 29 Region: 13-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  Aech_17776
Domain Number - Region: 487-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0603
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17776
Sequence length 2417
Comment [mRNA] locus=scaffold15:386184:564963:- [translate_table: standard]
Sequence
SCTSKYVGEYCQHLNPCYTGSRCQNGGSCRVREGIGGGTPSFTCSCPVGFTASLCEIPIE
NACDSSPCLNGATCNLKSLHEYVCTCSIGFTGDHCERQDYCASSPCRNGAGCRSLEDSYE
CTCAHGFTGPNCADDIDECERDPCRHGTCNNIHGSYRCMCSSGYTGQNCESDYIPCDPSP
CENGGSCHQLGEHDYECICSEGFRGDHCEENIDDCPGNLCQNGATCMDRVNEYSCLCPPA
FTGTQCELDVDECSVRPSLCHNGATCTNSHGSYSCICVNGWTGPDCSVNIDDCAGAACFN
GATCIDRVGSFYCQCTYGKTGLLCHLDDACTSNPCHEGAICDTSPINGSFTCSCATGYKG
LDCSEDIDECTQGSPCEHDGICVNTPGSFACNCTQGFTGPRCETNVNECESHPCQNDGSC
LDDPGTFRCVCMPGFTGTQCEIDIDECAIRPCMNGGTCSDLINAFKCTCAEGFTGIHCQI
NIDDCISSPCKNGGTCQDGIARYTCECPAGFTGDSCETNINDCASNPCRSGICIDGENSF
TCNCSPGFTGNLCQTQINECESNPCQFGGRCEDRIDGYLCVCRPGTSGENCEVNVNECYS
NPCRNGASCIDGINRYSCECEPGFTGQHCETDINECASNPCANGGLCVDLINGFKCDCPR
GYYDARCLSDVDECASSPCLNGGTCEDGVSQFICHCLPGYGGKRCEADIDECGSNPCQHG
GTCNDHLNGYSCKCLPGYTGTNCETNIDDCANNPCQNGGSCIDLVNDYKCVCELPHTGRN
CEDKLDPCSPNKCLHGAKCSPSSNFLDFACTCTVGYTGRLCDEDVNECVMTSPCRNGATC
MNTNGSYFCQCAKGYEGRDCIINTDDCASFPCQNGGTCLDGVGDYTCLCVDGFSGKHCEI
DIDECLSQPCQNGAICKEYVNSYTCQCQLGFSGINCQTNDEDCTDSSCMNGGTCIDGINN
YTCVCKTGYTGSNCQYRINECDSSPCQNGATCHDHIQYYTCHCPYGYTGKQCDKFVDWCA
ENPCENQATCVQHMNKYHCNCSPGWTGKVCDVEMVSCKDAAIRKGVPEISLCNNGTCENI
GNSHRCHCLDGYTGSYCQEEIDECDSAPCQNGATCKDLIGSYQCQCTKGFQGQNCELNID
DCRPNPCQNGGTCHDLINNFTCSCPPGTLGFICEVNIDDCTMTACHNNGTCTDKVGGFEC
KCPPGFVGPRCEGDINECLSNPCTSPGTQDCVQLVNNYHCNCKQGYMGRHCEVRMNFCDS
SPCQNGGFCMAKHNGHVCMCNNAYHGTNCEFAGSYCDSEPCQNGGTCRIIGNSYKCYCLP
GTTGMHCEFDAWNECDRHPCQQNAPCINKIGDYACDCPPTWSGKNCDTYDSNYAGGIFGN
TPKNMSDINLERERQKCVENDCKAKYNNGRCDEECNRLACEFDGNDCSLGVNPWRNCTAP
VDCWKLFMNGVCDEVCNNPQCLYDGRDCGPKLPPCNPIYDAYCRKHYANGHCDYGCNNEE
CDWDGLDCDKEPPSLAEGVISIAVRMDVDSFRTNIATFLRDLGHYLRTTLRVKTDELGNE
MIYPWKPEKNKLLNIYTRLTTPSNRKGAVTFLEIDNRKCTLAQGTSCFSSANEAAEYLAA
AALKQPLSLNFPIEQVRSIVGTQNTDYSDNPTNYKYVFIGVVIVVLGGLLVGVLVTAQRK
RAVGVTWFPEGFLRTSSGSGQRRRSRRRGPDGQEMRNLNKQPSVNCMSMDVVSARIQSQW
SDDESDLPPSKRMRAIEPGYASDHTVITDYEETEPRMWTQQHLDAAEIRRPDAGGVLTPP
SLEHGQDVDARGPCGMTPLMVAAVRGGGLDTGEEEDESDGTAAVIADLVAQGADLNATTD
KSGETSLHLAARYARADAAKRLLDAGADANSQDNTGRTPLHSAVAADAMGVFQILLRNRA
TNLNARMHDGTTPLILAARLATEGMVEDLINADADINAADNSGKTALHWAAAVNNVDAVN
ILLVHGANRDAQDDKDETPLFLAAREGSFEACKALLDTFANREITDHMDRLPRDVASERL
HHDIVRLLDEHMPRSPQMVTVIPNGPLMGSSNHPQLITHPTVIGSAPKQAKSKKRPKAGT
GNPNSPESEGGAVVMVRRKPSVKKPPAKPRGAQPPNQEIPQGAEGADGNLPTSPYDSASL
YSNALPLVAHTTTAKQPPPYEDCIKSQSMQGLQQLGLDTFTSNYGLPFHDQLLAPHQRQQ
QGMVNTLSPPHIPQASYMGSPSPAKNRPSLPTSPTHIAAMRQATHQKHGSMPPVGFDFEN
LPYSSSQQQQQQQQMQQTQQQIQQQQQQQQQQQQQPQPQQSTQQQQQQQQQQQQQQTQQY
YQYLTPPSHHSGPDVTPQHLMQAPESFPTPSPDSPGHWSSSSPRSNSDWSDCMASPTNAY
GAGGAHQSNKGSEAIYI
Download sequence
Identical sequences Aech_17776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]