SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17801 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17801
Domain Number 1 Region: 512-653
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 945-1063
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 609-733
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.13e-16
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number 4 Region: 1426-1547
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 728-866
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-16
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 6 Region: 1728-1853
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000124
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 7 Region: 832-946
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000173
Family Growth factor receptor domain 0.005
Further Details:      
 
Domain Number 8 Region: 1548-1627,1677-1735
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 336-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000167
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 10 Region: 1066-1186
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 11 Region: 467-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000434
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 12 Region: 251-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000014
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 13 Region: 1853-1915
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 14 Region: 1183-1310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000126
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 15 Region: 303-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000353
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 1345-1394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000218
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 218-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000346
Family EGF-type module 0.025
Further Details:      
 
Domain Number 18 Region: 33-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000306
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 19 Region: 166-204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000598
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Weak hits

Sequence:  Aech_17801
Domain Number - Region: 1313-1359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000368
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17801
Sequence length 2291
Comment [mRNA] locus=scaffold367:246152:271700:- [translate_table: standard]
Sequence
LFSSLSGILGDCLMEPPQWGTVRKRVLQDGTLQIVYSCESGRKLKGHKIATCTADGWDEP
VPKCVPHNILRRFRNDLYVGDQPIVPDRDKVQIAKDRLKTLERIDDLKKRRKTKEGNKRK
KKRKRPVKSSSRLPTATRLNETVVSQLDISUCVLSYRRKNVLPPYNRYLVAVYECADGYV
FVDSTTDRLFCSNGTWLGRRPRCVRDNKVIPADKVKRCDQGTGECEHVCEDTPSGIKCSC
FDGFRAKGPSCIDIDECAEGIAKCTDICRNEPGSYSCECHSGFQLGTDGRSCQDINECLS
NNGHGPCQGTCRNLKGSYECSCTDILGYKLAADNHTCEDIDECALNNANCSHLCLNTPGS
VFCLCPDGFYLTNDWKTCQDINECKETPKICAENTECENTVGSYKCTSTIHPHVVTKILR
EENYDDDNEDDDDEDGNNDDDYGEEITEIPQSSKCEHGFKKNENLECVDVNECAEIESHR
CQHECVNEPGGYHCACRPGYELAEDGATCKDVDECDVPSQPCSHICRNTDGAYVCECFSG
FMLTDDNATCVEEFKNCFSLIKPCSHTCEDTTEGPRCICPTGYELLDDRATCTDIDECAR
EAPCSHSDDHGCQHECVNLHGGYECVCHSGFVLDIDDRSCIDVDECAENRHDCSHECKNY
PGSYECVCPDGYRILQHARMCVDVDECAERSHGCSHECENEEGAYKCGCPSDMSLDGTGR
NCVLSDACKIANCSHACEKDRDTYRCVCQEGYILQKDEKTCLDMDECFEDEHDCSHECIN
ILGSYRCACPRDMKLLEDGLTCGDPICPQGLRQDEHGECQDIDECLEGEHECSHLCHNVY
RSYRCSCPSGWVLEDDSLTCVRSDPCSNSSCSHSCVPSDSGYKCECPSGYLLDGNTCKDK
NECEDEKHDCSHYCINTDGSYYCECPFGWRLREDSRTCQELPDDPCSKDHGCSHTCEQDD
DRVRCGCPEGYELQDDGKTCRDVDECSEGSHTCSDICLNVEGAYHCQCPSGFRLEDDHRT
CQDIDECSSEEADCSHGCLNINGTYNCTCPEGYELQDDDRTCEVVNRCVALNNSCSHSCI
SHNGTYECSCPAGYHIGEDGRTCEDINECIQDNGGCSHLCANTEGGVECACPENYELLKD
DGKTCVEINACSIDNGGCSHFCHHEDNRLFCSCPPGMVLSEETVCTYENDCLQDNGGCSH
LCYHEAGNVTCACPSGMILAEDQRLCVQEDGCAIENGDCSHFCHDHDVICECPEGYRLSS
RDNATCVDINECLELLDNCTHQCLNIPGGFNCNCNAGFSQNFQDPTLCDDIAECKXXLVG
TFKCQCPIGYVLEQNNKTCVLVDDCKNDNGNCSHHCHQADGPDGIPSTRCSCPPGFRLKR
DLKTCEDINECEEFENDVESGCSHTCVNTEGGYDCDDHSAXXXXXXXNECLTSHHNCTHD
CVNLLGGYTCTCYKGHYLHTDNFTCLDIDECFELNGGCSHNCTNTIGGHLCFCPTGYELS
QDEKTCIDIDECLIDNGGCDHKCVNTVGSFSCECPPNHESWNGSCRPFNPCRDHNGGCEH
ICAAVNGTVICSCEKGFQRDEIDGFKCRDIDECKEQHGCDHICVNNPGSYECRCKEGFQM
VNSTCEVSSSLENPRDNARFLVTQFRPFLPLPYLCSSFEACCKTRLARAEVSRGTTVCVC
GFFSLPFFLFFLDVDECAAGICKGNKCTNVPGSYRCECEAGYRFHGDTCVDVDECLEETP
CSERCVNTPGSYYCTCSVGFQLEGNKYIDECEWRRDRCDQECINTVGSFVCACRAGYTLI
LRSHCQDVNECLNGNGGCTGECINTAGSYYCVCSEDLVLAPDERTCVSPTSECRAMEPPI
HGEIRCPGHPSGASVYPQGAKCHVRCRRGFRLEGAHTRHCVSDGHWNGKEPICLREVATD
PLYNPSITRFHNTPQPFVSCPQDMDVELPARQNTIRVTFPQPKSNMDWWSNSVACLSRWS
LYSSFFPFMFFRYVHASPPWAKQLQADLPAGTTVVTFTAWSPVSNYTSTCRIVIRVRDTE
NPKVTMCPVSFEVRLSPGERNRLIFWQEPTFTDNVGVGHVYKTRGPGHVMYPGIHDVRYI
ASDAAGNRAECHFSIHVRAPHTSLHPESARRINSTPTLQSNSDISKSSSRREIHVDRKIG
DRGSKIRIRPSSDRPSFFVDSRHPIIDISNLDYKAYRYKLIEATLRKQYDDFQPPGDVVL
NSLHLNSADSVIDVRLNDRYNHSLFDFVEEYYDIGDATSRKNVERLHPLDHFLSKGTRRP
RTSEKETATIS
Download sequence
Identical sequences Aech_17801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]