SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17813 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17813
Domain Number 1 Region: 283-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.58e-24
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number 2 Region: 104-203
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-16
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 61-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000371
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_17813
Sequence length 899
Comment [mRNA] locus=scaffold788:247423:254386:+ [translate_table: standard]
Sequence
APRLDLESLESGYHGLVKENETLVEVTPQIRALGTKVCSFRIANKHHGEAPFEIVLKEKG
MAELRAFRVLNCEKRRNYKFDIAAVGCNGVQSENATVHITVVDVNEYAPQFLQPAYVSTV
DEGRLYEEVVRVEASDRDCTPKFGDVCKYEILTADQPFIIDNEGAIRNTEPLDYERSHNY
ILSVVAYDCGMKQSAPAMVTVKVNRVCAPGWRGIPERVDYAAGVGSQPLLPSARLDLCDA
PCILRNVRATLTLATDHIGKGCDRDTYGVRSQRKLCGASRDSVDLLPTPGPTTSWTAGVD
SAAIVPNDVLEHSLAQKFTIGVWVKHRPRPRQDPHVKEHILCAADDHKMNRHHYALFIRN
CRLILLLRRDFSEGDPNIFRAAEWRWKLGQVCDDKWHHYAIQVDFPRVNLYVDGEEWHAD
EKNPEVIDDWPLHPAKGVNTTLVVGACWQGSENKTKHHFRGYLAGLSVLVGRNEKPEVLS
CLRRCQEGIHVPPMDLLQPGTQLLTNSDMTEVRIDGDNRTNVETLLRRIGYSNTRRFPTP
GRRNFRLDTTIVCEGSENTPLPVPTVQSYVTVLPPPRPGITVNGTGYVAREYADFRLGVR
VFPDARVTAGSAARLDACAVSVYPSLNPDHESLGLPGDALLAFHDISARVDRDGVVLSGA
DSPYNYQQLIRLIMYTNRKPAYYLDRVFKLTCSELSGRFASNEYVQTLAVIHPKEKTTVL
PHTTPGEPPIARIVEPAPGHAQLSPHHADLTEEYATAALREGSRTISGTGSSHAVTIVAA
ACIGFLLLMAVVGAARVRGAAKRRRSAGDELAAETEMAWDDSALAITVNPMDRLTEHDQH
HQSQRDEDVDDSGSSDSEDGSFRDDDLDSSDCENDCDLSNGRHRRHNSPHDLEWDHRDV
Download sequence
Identical sequences Aech_17813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]