SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_17850 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_17850
Domain Number 1 Region: 49-350
Classification Level Classification E-value
Superfamily Kelch motif 7.19e-45
Family Kelch motif 0.026
Further Details:      
 
Domain Number 2 Region: 1397-1546
Classification Level Classification E-value
Superfamily Fibronectin type III 3.36e-17
Family Fibronectin type III 0.0000735
Further Details:      
 
Domain Number 3 Region: 349-395,1381-1426
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000694
Family Fibronectin type III 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_17850
Sequence length 1587
Comment [mRNA] locus=scaffold274:357624:368475:+ [translate_table: standard]
Sequence
MAAPMLKWKRIANPTGPQPRPRHGHRAVAIKDLMVVFGGGNEGIVDELHVYNTATNQWFV
PSTKGDIPPGCAAYGFVVDGTRIFVFGGMVEYGKYSNELYELQASRWEWKRLKPKPPKHE
PPPCPRLGHSFTLIGNRVFLFGGLANDSDDPKNNIPRYLNDLYTLELLPNGHTAWDVPQT
HGHAPPPRESHTGVAYTDRTTGKSCLVIYGGMSGCRLGDLWFLDVDSMTWNKPVVHGPTP
LPRSLHTATLIGHRMYVFGGWVPLVVDDVKVATHEKEWKCTSTLACLNLETLTWEQLTVD
SLEENVPRARAGHCAVGVHSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPAAPSRVQL
IRASTQSLEVSWTASPSAQYYILQIQKYDMPPVAATGSAYPLVSAPTPTAPIISTPVATT
TSAMVATPTTIPVTSPPVTTIAVLPSTTPPCRRVATAVATAVATPLRIQSASPVQKPVSS
QAVQKSISPMTPRVATGNVIRIRSPLVTSSAAVATAAVAVVTTEQQQTTVTTITTTTTTT
AGQTPAAMSGIAALAAAAAATPKITMNNVSIVPQTAVATATASNTIRMKNVQPGQQIRFA
APGATVLRTASPQQSKQIILQKPGQNIAGQPQIVHLLKTGQGMVVPKVSLIPGKSVQTTG
AKPLNQGPTILRLVNPNTVAGSKILTTMKTSNIVTMSKGQNITGKQTIMITKPTGNSGLV
GRTNQFIVVTTGSGLRAVQAVTTSQAGAGQGATSVATPVNVLPLSATNHVTNQQGVKMIV
VSSGAMGGGTAGKPLTITVPGQGGVPKTVTIAAKTGAQTIFNTSKNQLVTVPQIQKAPEA
VAVSGKPVTLQMPAGISAKTVTLLPTSSSSIVTTSASDSIDASKMLFVSSQKQPSASLAS
TSDGPATTDAALAALAAEAGLIDPVQESSGGLSFMVTTDDGAGGDDKMEDSCNGNEATTA
AALVSQMGAGEPMQVDGDGNFVLPQVDGPIDDLLLEDEDKMDVDEEPAAENVTESNAELA
EVTEQNVDVSENIQTEGSTVKEVAEAGEKNEATTADLPESITTNETEKAKDVNNSSVDDK
AAMEINADDSELPSEKEEIKDSQSVIDDEKVIKSELPLVQSAIEASSEQTSLTDVVNPIT
EIDETQQDEDNLVKDIKCESLSENEKSLISENLTEDTDASHQPQDNTQKIEIKDEIEDLE
SDLPTESSLIKSNEDDEPMITDNSTSIATDNVITPVIIPTIQMKSEPEDEFIKHEQAILP
DLPISPINGVAAPVEKEMEKVHTPMKMEIKDDFVISKKENLQREKQEKINDARSETGDDS
TALTTLATAALGSAEPTMKIKNEQSEEEKKEAEWYDVGVIKGTSFTVQHYYLPGDEPLDV
TQNLTMDVFKGRTKIAVEPGTAYKFRVAAVNSCGRSAWSEVAAFKTCLPGFPGAPSAIKI
SKSIDGAQISWEPPSSNVGPILEYSVYLAVRSTALNNDGEPKTIVSNPNQLAFIRVYCGS
SNFCSVNNSALNAAHVDTTTKPAIIFRIAARNDKGYGPATQVRWLQDPTTAVKNNSQAKR
PASTDLRSQVTSPQKKMKTEPPSDNFS
Download sequence
Identical sequences Aech_17850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]