SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00431 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00431
Domain Number 1 Region: 309-433
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 2 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 3 Region: 247-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000357
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 146-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 185-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000205
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  Aech_00431
Domain Number - Region: 34-189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0004
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_00431
Sequence length 753
Comment [mRNA] locus=scaffold326:1400111:1414293:+ [translate_table: standard]
Sequence
MRLTTQKWLDVDPDWTVDDFASAHSRIEYEYRVTCAPHYYGKGCEDLCRPRDDNFGHYSC
SPSGERVCLTGWKGDYCNTPRCLPGCDEQHGHCNRPNECICHSGWKGSLCNQCVRYPGCL
HGSCQKPWECACDEGWGGLFCNQDLNYCTNHKPCMNGGTCFNTGQGSYTCSCPSGFTGTE
CQTPLFDCHSKPCLNGGTCTMTESPSVSYVSGNGTELSSSSRQQHRRSYRCTCPPGWRGR
HCEITTRSCRDSPCRHGATCEDDSLRGYVCHCPSGYTGTDCESQVNECSPNPCANNGTCM
NHVNSYRCTCLAGFTGERCEINVDDCEGDPCLNGGTCKDQVNSFRCQCIPGYVGRICQNK
VDYCVAKPCANGGTCISGTNDYNCTCKPGFTGKDCSVDVDECWSAPCQNGGICRNRVNGF
LCECPDDWHGDICSEKAGAIPITSSSTPVISNVPLAEPFPGNSHSKHVASRKTSLTTEHL
VMIATLSTAVPAFALFATVAVMCMKRRQKREQAKADEEARLQNERNAVHSSMSKRSASTI
GVGGTGIGSVGGLLGGGSGLIGAGGGSVCALGTGDAHMIKNTWTASKSVNNVASAASRQD
DLDSSFQTDVTLDSSCSGYKPEPVLQDGRTTRTTKQLNTEAAAHRASAHLFQKEKDCLGL
GLGIGILESAKRSSVFATTGNVADSCCAAEAALMKRPTTISEANSTGLVNSNSSGPPGSG
GSAADNSNCGVYVIDDHYVRHDATLAATLATEV
Download sequence
Identical sequences F4WM36
Aech_00431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]