SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00648 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00648
Domain Number 1 Region: 38-119
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000000000000144
Family Hormone receptor domain 0.0065
Further Details:      
 
Domain Number 2 Region: 116-440
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000032
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_00648
Sequence length 460
Comment [mRNA] locus=scaffold192:625786:628853:+ [translate_table: standard]
Sequence
MLGMSTFGNMSEATGINLFGYNVTDEDQLEKYRGVESNGTKIRQCPPFFDGLLCWSRTDA
PGTATLPCPPASVMGYTDFASDNLRKLAVASKDCLANGEWYKNSDGISWSNYSLCVLNLT
RHIEKNYLPLYETPAEFALLNKWLPIIRMISHIGYITSFTILIVAMVVFSLLRKLRNPRN
RLHMHLFASFIMRAFMALLKDWSFIGGIGLTWHVVFIDENAFIKEENTWICKVITSLWQY
FIVANYSWTLMEGLYLHNLVFLALCTDSSTISLYIALGWGLPVLVVVPWIIFRATIEDTL
CWTTHNNSSLFLIIRIPMIICILFNFLLFLNIVRVLLVKLKTSVHLQRKKMKYKRWAKST
LVLLPLFGIHYTIYLGLSYHKDYRVELVGLFCDQLFASFQGAFVAFLYCLLNGEVRAEMH
RAWKARRSKREVDSFISGHTRNSRDGINRKRLDRRTTILR
Download sequence
Identical sequences F4WC88
Aech_00648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]