SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_00725 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_00725
Domain Number 1 Region: 410-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family EGF-type module 0.086
Further Details:      
 
Weak hits

Sequence:  Aech_00725
Domain Number - Region: 137-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0147
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_00725
Sequence length 626
Comment [mRNA] locus=scaffold192:2209888:2221736:- [translate_table: standard]
Sequence
MERRLPTACSMTEKRCSRRSFRPWIVLATILFGQLLQQVRGEIYTKMFSSQQNPSDPCYD
EDRPRRCIPDFVNAAFGATVEASSTCGTGGPTRYCDVTDEPGGTTGIGHCHVCDDSTPRR
RFPASYLTDLNNPNNVTCWRSEPLVSSQSFSAPPDNVTLTLSLGKKYELTYVSLQFCPRA
AKPDSIAIYKSMDYGKTWQPFQFYSSQCRRVYGRPNRATITKANEQEARCTDSHRYTGGD
GLGPVGRIAFSTLEGRPSAADFDNSPVLQDWVTATDIRVVFNRLHMPQQSNPDQVPHNGE
EHHVAAIGLEELTKREREREERLKNQKNAILHAQDPLVTALPSVHQVIAPQEMQSNDAID
AAVRDMGFVPVTISTTTTTLASVAMNGLGPATATMAHHYAVSDFAVGGRCKCNGHAARCI
PGKDGEVVCECRHNTAGRDCERCRPFHFDRPWARATARDANECKVCIGMKLILYLDPDYL
NTNTKSVNLDPFHAIIESRREETRNVGGPVVFAPFLAFLIFDIRRAPPDGKLCEFVPRRS
VGALDDFITEILLQLSGRYGDGHPRVLARSARCVRCERRGKKRRGGWRTLPFLLLRIATL
EKEKSGSGTQGSREEHELNVYHGMHS
Download sequence
Identical sequences F4WCF4
Aech_00725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]