SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_01717 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01717
Domain Number 1 Region: 45-282
Classification Level Classification E-value
Superfamily L domain-like 1.91e-38
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 277-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000279
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01717
Sequence length 680
Comment [mRNA] locus=scaffold7:1575859:1577901:- [translate_table: standard]
Sequence
MLVTRPHPLGGRILLALFLLTGCFALLSRAAAFPDWTDCPAVCRCKWTSGKKSALCPDAG
LTSLPASLDPDMQVLDLSGNKIPALKEEIFKLAGLVNLQRVFLRNAGIYNIHANSFKDMR
ILIEIDLSDNHVTVLKPDTFLGNERLRILILSGNPLGTLRNLQFPVLQHLRNLELQRCSL
TEVHGQAFARLTGLEFLKLDTNQLEYLESSVISGLSRLKTLTLDGNQWRCDCRLRDFRTW
LIPDVPSKLYSVPQICSGPPRLEGRRWEDVKPTEFACEPKVFVLASSIQEETNGNLSLAC
RTSGDPEPEVWWQLNGGPVNATKSTDQPYMGTLVIYATSEAGIPSNDKSASRTVGDRWSN
LTVYNASDSDAGEYACFAKNIAGLARDTVSVAIPRVYTAPTLSQSDNWLLWVSLAGGGAA
AACASISAVLLVLCLCGGNRRHSKREKVKLQSSSSFGDQEKKLLDLSVTTTTTPGNSNDR
GSGHGSIGEACSTGDLELAERSSICDPMAAAAVTVERLRPADNSVNTIRAVPCTATATAG
IFPPPPPEFTTGVLPAGIFGNIFISVSLPQDASSERCYPDLLDIPVHAVSGATTTVSTGG
KTAALPSAAAINVSSFATLPRRALRSTEVAAGSPYDNMGPRITANGSSAFSLTDMTDMDL
RLSPPPPPRIIQPPHEFVSL
Download sequence
Identical sequences F4X3R4
Aech_01717 XP_011064989.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]