SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02759 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02759
Domain Number 1 Region: 1194-1397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-32
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 260-384
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-25
Family Cadherin 0.0006
Further Details:      
 
Domain Number 3 Region: 602-709
Classification Level Classification E-value
Superfamily Cadherin-like 7e-24
Family Cadherin 0.00096
Further Details:      
 
Domain Number 4 Region: 492-608
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 697-828
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 6 Region: 814-918
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000357
Family Cadherin 0.0031
Further Details:      
 
Domain Number 7 Region: 156-272
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000514
Family Cadherin 0.0041
Further Details:      
 
Domain Number 8 Region: 423-498
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000989
Family Cadherin 0.0082
Further Details:      
 
Domain Number 9 Region: 920-1019
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000642
Family Cadherin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_02759
Sequence length 1591
Comment [mRNA] locus=scaffold316:2464364:2485835:- [translate_table: standard]
Sequence
MHTQGSRASERASEQTNECGREDVVETVGGHRRPIPSRPIPSRPIPLVGTGVTESGEWKR
KSGEVYRCDFSPSRETGVREAWFSFDYRYGMHLQRIMHPRGGTFARSQPYPGDRSFFCTI
LWLRIPSATRLRHSRHLDERSQFPGEGKLSLDENHNHKPVFSNCSNYAPVLKEEQPPHTK
VIQVHADDRDPPEDGGTVTYSFLIAPGDRIKFEIDNKTGLITTTQVLDRDEPAREKEAYL
TILATDNGRPQLDAICALKVIIEDENDNKPAFDKASYTENVPQDLPVGHEVMRVSATDID
DGNNSVVRYSLSAERPDDAAYFRIDRESGVIFLNKTIDRIPGSKFSMIVTATDLGEKPQS
DSTYFDIQVVESHKKAPAFLPRSSEPIKIKENFTNFDASIVRLQAISNIDNSSNWNNTPS
SNLLFELVTGTTEQSNKGNTFRLEFNKDIADIKLSRQLDYERNTQYSLIVRVKNNYELAA
ETVVDIEVLDVNDNIPVFSDLKQGSVLENEPLGVPVMQVQAIDADGTSANNQVTYALDNF
KDLFAIDPITGNITTLMTFDREQQDIYNVKVIATDNSPSALFKTGEHNKGQQAFTIKIAD
KNDNPPRFTQKVYTHNSVYENVNINAPVTEVTARDLDTENPVTYSIISGNTDDSFYIEAT
TGKIRVNKPLDYEKITKYNLTVRAFDGLFNDTAQVEIFIENVNDNPPVFEDFDKNPTIEE
EKLVEDCVTTVVAYDPDIEDRNADQHIAYFIAKEEQQPLIGIDKYGCMKLKKPLDRDPPN
GFSTWTVIVMARDEDGSSMAFRESVVVNITLTDINDNAPFLDMPYPVIWDENKPPGKITE
LKARDYDSDDNGPPFDFRIDDTADNEIRSKFDIRDNNLYARAVFDREMQKSYDIPIAITD
SGSPPMTGTSTLTVIIGDENDNPMREGSSSIFVYNYKGEAPDTEIGRVYVNDPDDWDLPD
KTFKWVSPHDGFHLDTSTGMITLLSGTSNDTFVLQFVVTEQSKLIPWHQVQAYVNVTVKE
LPEEAVHRSGSVRFYGITAEQFVEPDESGVSKKDIFQEKLATMLNTSIENVDVFTVLHSP
HHNNKSLLDIRFSAHGSPYYAPEKLNTIIAQHSKEIEREMKADILLMNIDECLFEKLHCN
DSCRNFLNTSTVPYVVYTNTSSFVGVRAIADPLCTCHVAEPVVCLNGGTPLAERCECPPG
LEGPRCELLGIGFHGDGWAIMPPPDQACDDSHLGLEITPHVDNGLVFYFGPMTYNPKLGI
QDFMSLELQQGFAVLYVDYGTGTVRLDQKQIKLTDGKSHRIDVYWKKTSIEMVVDKCGIS
ACMSLTAPQGTNEFLNVNSPMQVGGTVTNLAHLASNLRWDYKPTTKGFIGCIRNMTFNGN
TYNLGMPSLSRNADPGCDHGMTKAISFGIDTNFIVAILVCVLILLILLVAVVVHRRKTDD
LYKDMDDIRENIINYEDEGGGEVDTGYDLNVLRAIYDAPPIDSKIAPVGLQSRGTDEVPD
ICGFLDGKKESCDKDPDTNPFDDVRHYAYEGEGNSEGDLSSLASCTDDGDLKFNYLSNFG
PRFRKLADMYGEDPSDEESDGVGERESESWC
Download sequence
Identical sequences F4WLD0
Aech_02759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]