SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aech_02791 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_02791
Domain Number 1 Region: 990-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-39
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 2 Region: 476-601
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-30
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 1242-1432
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-28
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 4 Region: 35-141
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 245-375
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-23
Family Cadherin 0.0003
Further Details:      
 
Domain Number 6 Region: 135-257
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-19
Family Cadherin 0.00069
Further Details:      
 
Domain Number 7 Region: 586-702
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000271
Family Cadherin 0.0032
Further Details:      
 
Domain Number 8 Region: 363-488
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000457
Family Cadherin 0.002
Further Details:      
 
Domain Number 9 Region: 1475-1514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000093
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 10 Region: 703-801
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000186
Family Cadherin 0.012
Further Details:      
 
Domain Number 11 Region: 1436-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  Aech_02791
Domain Number - Region: 910-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_02791
Sequence length 1698
Comment [mRNA] locus=scaffold135:1213:19416:- [translate_table: standard]
Sequence
MFTRRRWDDAALSAKRRDRECGVTKFIRIGIADKNDNPPYFDKGLYEAEVDENEDIQHTV
LTVTAKDHDESSRIRYEITSGNIGGAFAVKNMTGAIYVAGALDYETRKRYELRLTASDNL
KENYTTVVIHVKDVNDNPPVFERPNYRTQITEEDDRTLPKRVLGVTATDGDKDRPQNIVY
FLTGQGIDPDNPANSKFDINRTTGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGY
ADVQVNLKDINDNAPIFPQGVYFGNVTENGTAGMVVMTMTAVDYDDPNEGTNARLIYSIE
KNVIEEETGSPIFEIESETGVIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIRVK
DINDMPPQFTKDEWFTEVDETEGPDLPEMPILTVTVHDEDETNKFQYKVIENSGYGADKF
TMVRNNDGTGSLKIVQSLDYEDQLQSNGFRFRIQVNDKGEDNDNDKYHVAYSWVVVKLRD
INDNQPQFEKANIETTVPENARIGSSLETFKATDPDQGGKSKVSYSIDRSSDRKRQFFIN
ENGTVSIQRSLDREETPRHQVKILAIDDGIPPKTATATLTVVVQDINDNPPRFLKDYRPV
LPEYAQTKKVVEILATDDDDRSRSNGPPFTFRMDPNANDVIRASFKVESDNKGANGDGMA
VVSSLRSFDREQQKEFLIPIVIKDSGNPSMSGTSTLTVIIGDVNDNKMQPGSKEIFVYNY
AGQSPDTEIGRVYVYDLDDWDLPDKKFYWEGLEHAQFRLDEDSGMIFMKSGTHDGKYHLR
FKVYDRKHTQTDVPANVTVTVKSIPHEAVLNSGSVRISGITDEDFIRVWNYQNQTLSRSK
ADLFRDKLSHLLNIDRDNVDVFSVQLRRVHPPLTDVRFAAHGSLYYKPVRLNGIVLMHRE
EIEKDVGINITMVGIDECYYENEMCEGSCTNTLDISNLPYMVNANRTALVGVRVDVIAEC
TCGARNFSKGESCRNSPCYNGGRCVEDRFGLSCQCPSGYNGPRCQQTARSFRGNGWAWYP
ALEMCDNSHLSFEFITRKSDGLLLYNGPIVPPEVDEVMVSDFISVELERGIPRLLIDFGS
GTLELKVKPKKTLDDGEWHRLDIFWNTETVKLIIDYCKSAEISELEDGSPPEFNDTSCQA
TGTIPPFNEYLNVNAPLQIGGLYVEQFDPSHYKWKHMPVGKGFDGCIKNLFHNSKLYDLA
HPGLSRNSVAGCPQTEEICNNQETTFRCWEHGTCVGSFTEARCQCNPGWTGPGCMTPTIP
TTFKPQSYVKYALSFEPDKYSTQVQLRFRTREMHGELFRVSDQHNREYAILEXXXXXLSA
IAVDDGQWHTVRVSRYGSAATLELDGGEGRRFNETFSFEGHQWLLVDKQEGVYAGGKAEY
TGVRTFEVYADYQKGCLDDIRLEGKHLPLPPAMNGTQWGQATMARNLERNCPSNKPCANV
ICQDPFECIDLWNEYDCTCGEGRIPSPDNKGCMDKNECIDYPCLNGGRCINQDPRFRYRC
ICPDGFWGENCELVQEGQTLKLSMGALAAILVCLLIILVLVLVFVVYNRRREAHIKYPGP
DDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPIPEMGGKLPPCKVAYPLGPEPNVG
VFIEDHKKRADSDPNAPPFDDLRNYAYEGGGSTAGSLESLASGTDDEQHEYEYLGAWGPR
FDKLADMYGPAEESEEEE
Download sequence
Identical sequences F4W7A2
Aech_02791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]